BLASTX nr result
ID: Glycyrrhiza35_contig00006161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00006161 (619 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAB36495.1 histone H3.2, partial [Medicago sativa] 246 5e-81 AIY27744.1 histone H3 protein [Betula luminifera] 246 7e-81 ACG38891.1 histone H3 [Zea mays] 246 7e-81 WP_039311726.1 MULTISPECIES: hypothetical protein [Bacteria] NP_... 246 7e-81 CAN70652.1 hypothetical protein VITISV_010022 [Vitis vinifera] 246 7e-81 CBI23573.3 unnamed protein product, partial [Vitis vinifera] 246 1e-80 GAV83258.1 Histone domain-containing protein, partial [Cephalotu... 246 1e-80 KXG30479.1 hypothetical protein SORBI_004G188000 [Sorghum bicolor] 246 1e-80 EMT02210.1 Histone H3.3 [Aegilops tauschii] 246 1e-80 KJB17320.1 hypothetical protein B456_003G041300 [Gossypium raimo... 246 1e-80 XP_017230674.1 PREDICTED: histone H3.3 isoform X1 [Daucus carota... 246 1e-80 XP_010106281.1 Histone [Morus notabilis] EXC09698.1 Histone [Mor... 246 2e-80 NP_001078516.1 Histone superfamily protein [Arabidopsis thaliana... 246 2e-80 KQK19720.1 hypothetical protein BRADI_1g49990, partial [Brachypo... 246 2e-80 GAQ89306.1 Histones H3 and H4 [Klebsormidium flaccidum] 244 2e-80 ACG48841.1 histone H3 [Zea mays] 244 2e-80 NP_001281232.1 60S ribosomal protein L32 [Zea mays] XP_013447192... 244 2e-80 XP_006425525.1 hypothetical protein CICLE_v10026741mg [Citrus cl... 244 2e-80 XP_002985522.1 hypothetical protein SELMODRAFT_269004 [Selaginel... 244 2e-80 BAS95979.1 Os06g0130900, partial [Oryza sativa Japonica Group] 246 2e-80 >AAB36495.1 histone H3.2, partial [Medicago sativa] Length = 127 Score = 246 bits (627), Expect = 5e-81 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 3 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 62 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 63 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 122 Query: 361 RGERA 375 RGERA Sbjct: 123 RGERA 127 >AIY27744.1 histone H3 protein [Betula luminifera] Length = 136 Score = 246 bits (627), Expect = 7e-81 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >ACG38891.1 histone H3 [Zea mays] Length = 136 Score = 246 bits (627), Expect = 7e-81 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >WP_039311726.1 MULTISPECIES: hypothetical protein [Bacteria] NP_195713.1 Histone superfamily protein [Arabidopsis thaliana] NP_196659.1 Histone superfamily protein [Arabidopsis thaliana] NP_849529.1 Histone superfamily protein [Arabidopsis thaliana] NP_001031816.1 Histone superfamily protein [Arabidopsis thaliana] NP_001078517.1 Histone superfamily protein [Arabidopsis thaliana] NP_001131417.1 uncharacterized protein LOC100192746 [Zea mays] NP_001234218.1 histone H3 variant H3.3 [Solanum lycopersicum] NP_001235785.1 uncharacterized LOC100305466 [Glycine max] NP_001268032.1 histone H3.3 [Vitis vinifera] NP_001295710.1 histone H3.3 [Jatropha curcas] NP_001304168.1 uncharacterized protein LOC100194139 [Zea mays] NP_001311109.1 histone H3.3 [Zea mays] NP_001328124.1 Histone superfamily protein [Arabidopsis thaliana] NP_001329167.1 Histone superfamily protein [Arabidopsis thaliana] XP_001752178.1 histone H3 [Physcomitrella patens] XP_001752234.1 histone H3 [Physcomitrella patens] XP_001752318.1 histone H3 [Physcomitrella patens] XP_002300726.1 hypothetical protein POPTR_0002s02830g [Populus trichocarpa] XP_002306294.1 hypothetical protein POPTR_0005s07340g [Populus trichocarpa] XP_002307702.1 histone H3-D family protein [Populus trichocarpa] XP_002309961.1 hypothetical protein POPTR_0007s05050g [Populus trichocarpa] XP_002310848.1 hypothetical protein POPTR_0007s13920g [Populus trichocarpa] XP_002270349.1 PREDICTED: histone H3.3 [Vitis vinifera] XP_002278809.1 PREDICTED: histone H3.3 [Vitis vinifera] XP_002278833.1 PREDICTED: histone H3.3 [Vitis vinifera] XP_002467760.1 hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor] XP_002437756.1 hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor] XP_002510489.1 PREDICTED: histone H3.3 [Ricinus communis] XP_002510490.1 PREDICTED: histone H3.3 [Ricinus communis] XP_002513959.1 PREDICTED: histone H3.3 [Ricinus communis] XP_002873489.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] XP_002977792.1 hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] XP_002986910.1 hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] XP_003538608.1 PREDICTED: histone H3.3 [Glycine max] XP_003538611.1 PREDICTED: histone H3.3 [Glycine max] XP_003545047.1 PREDICTED: histone H3.3 [Glycine max] XP_003550410.1 PREDICTED: histone H3.3 [Glycine max] XP_003557131.1 PREDICTED: histone H3.3 [Brachypodium distachyon] XP_003557133.1 PREDICTED: histone H3.3 [Brachypodium distachyon] XP_003579868.1 PREDICTED: histone H3.3 [Brachypodium distachyon] XP_003589384.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003628560.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003635681.1 PREDICTED: histone H3.3 [Vitis vinifera] XP_004146875.1 PREDICTED: histone H3.3 [Cucumis sativus] XP_004152625.1 PREDICTED: histone H3.3 [Cucumis sativus] XP_004237940.1 PREDICTED: histone H3.3 [Solanum lycopersicum] XP_004238326.1 PREDICTED: histone H3.3 [Solanum lycopersicum] XP_004250115.1 PREDICTED: histone H3.3 [Solanum lycopersicum] XP_004287213.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] XP_004288164.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] XP_004288400.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] XP_004299672.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] XP_004499230.1 PREDICTED: histone H3.3 [Cicer arietinum] XP_004509059.1 PREDICTED: histone H3.3 [Cicer arietinum] XP_004952850.1 PREDICTED: histone H3.3 [Setaria italica] XP_004964429.1 PREDICTED: histone H3.3 [Setaria italica] XP_004975802.1 PREDICTED: histone H3.3 [Setaria italica] XP_004984150.1 PREDICTED: histone H3.3 [Setaria italica] XP_006342014.1 PREDICTED: histone H3.3 [Solanum tuberosum] XP_006363289.1 PREDICTED: histone H3.3 [Solanum tuberosum] XP_006366221.1 PREDICTED: histone H3.3 [Solanum tuberosum] XP_006284722.1 hypothetical protein CARUB_v10005986mg [Capsella rubella] XP_006284727.1 hypothetical protein CARUB_v10005990mg [Capsella rubella] XP_006302978.1 hypothetical protein CARUB_v10021126mg [Capsella rubella] XP_006382893.1 hypothetical protein POPTR_0005s07340g [Populus trichocarpa] XP_006380404.1 hypothetical protein POPTR_0007s05050g [Populus trichocarpa] XP_006390289.1 hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum] XP_006399597.1 hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum] XP_006426330.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] XP_006426331.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] XP_006435124.1 hypothetical protein CICLE_v10002817mg [Citrus clementina] XP_006466265.1 PREDICTED: histone H3.3 [Citrus sinensis] XP_006473607.1 PREDICTED: histone H3.3 [Citrus sinensis] XP_006591489.1 PREDICTED: histone H3.3 [Glycine max] XP_006650156.1 PREDICTED: histone H3.3 [Oryza brachyantha] XP_006652345.1 PREDICTED: histone H3.3 [Oryza brachyantha] XP_006655750.1 PREDICTED: histone H3.3 [Oryza brachyantha] XP_006827997.1 PREDICTED: histone H3.3 [Amborella trichopoda] XP_006838082.1 PREDICTED: histone H3.3 [Amborella trichopoda] XP_006849278.1 PREDICTED: histone H3.3 [Amborella trichopoda] XP_007047866.1 PREDICTED: histone H3.3 [Theobroma cacao] XP_007160694.1 hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris] XP_007163667.1 hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris] XP_007207357.1 hypothetical protein PRUPE_ppa013166mg [Prunus persica] XP_007223801.1 hypothetical protein PRUPE_ppa013185mg [Prunus persica] XP_007226054.1 hypothetical protein PRUPE_ppa013183mg [Prunus persica] XP_008235104.1 PREDICTED: histone H3.3 [Prunus mume] XP_008219337.1 PREDICTED: histone H3.3 [Prunus mume] XP_008221310.1 PREDICTED: histone H3.3 [Prunus mume] XP_008372995.1 PREDICTED: histone H3.3 [Malus domestica] XP_008386124.1 PREDICTED: histone H3.3 [Malus domestica] XP_008338566.1 PREDICTED: histone H3.3 [Malus domestica] XP_008343325.1 PREDICTED: histone H3.3 [Malus domestica] XP_008444859.1 PREDICTED: histone H3.3 [Cucumis melo] XP_008453806.1 PREDICTED: histone H3.3 [Cucumis melo] XP_008645853.1 PREDICTED: histone H3.3 [Zea mays] XP_008645854.1 PREDICTED: histone H3.3 [Zea mays] XP_008645855.1 PREDICTED: histone H3.3 [Zea mays] XP_008659340.1 PREDICTED: histone H3.3 [Zea mays] XP_008779899.1 PREDICTED: histone H3.3 [Phoenix dactylifera] XP_008790920.1 PREDICTED: histone H3.3 [Phoenix dactylifera] XP_008790921.1 PREDICTED: histone H3.3 [Phoenix dactylifera] XP_008810061.1 PREDICTED: histone H3.3 [Phoenix dactylifera] XP_008777683.1 PREDICTED: histone H3.3 [Phoenix dactylifera] XP_009130061.1 PREDICTED: histone H3.3 [Brassica rapa] XP_009125263.1 PREDICTED: histone H3.3 [Brassica rapa] XP_009131189.1 PREDICTED: histone H3.3 [Brassica rapa] XP_009104699.1 PREDICTED: histone H3.3 [Brassica rapa] XP_009373084.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] XP_009365825.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] XP_009339588.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] XP_009348044.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] XP_009383133.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] XP_009391324.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] XP_009391325.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] XP_009417592.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] XP_009418322.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] XP_009622923.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] XP_009623907.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] XP_009589379.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] XP_009799309.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] XP_009799310.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] XP_009771876.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] XP_010061026.1 PREDICTED: histone H3.3 [Eucalyptus grandis] XP_010027928.1 PREDICTED: histone H3.3 [Eucalyptus grandis] XP_010105254.1 Histone [Morus notabilis] XP_010267031.1 PREDICTED: histone H3.3 [Nelumbo nucifera] XP_010267040.1 PREDICTED: histone H3.3 [Nelumbo nucifera] XP_010272988.1 PREDICTED: histone H3.3 [Nelumbo nucifera] XP_010272989.1 PREDICTED: histone H3.3 [Nelumbo nucifera] XP_010272990.1 PREDICTED: histone H3.3 [Nelumbo nucifera] XP_010419651.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010431986.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010431987.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010431988.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010437129.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010453132.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010491788.1 PREDICTED: histone H3.3 [Camelina sativa] XP_010533621.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010533639.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010536364.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010539857.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010539858.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010526662.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010526992.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] XP_010679856.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] XP_010681007.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] XP_011016807.1 PREDICTED: histone H3.3 [Populus euphratica] XP_011022826.1 PREDICTED: histone H3.3 [Populus euphratica] XP_011022827.1 PREDICTED: histone H3.3 [Populus euphratica] XP_011025928.1 PREDICTED: histone H3.3 [Populus euphratica] XP_010939695.1 PREDICTED: histone H3.3 [Elaeis guineensis] XP_011028962.1 PREDICTED: histone H3.3 [Populus euphratica] XP_010940939.1 PREDICTED: histone H3.3 [Elaeis guineensis] XP_011045138.1 PREDICTED: histone H3.3 [Populus euphratica] XP_011013190.1 PREDICTED: histone H3.3 [Populus euphratica] XP_011074645.1 PREDICTED: histone H3.3 [Sesamum indicum] XP_011097534.1 PREDICTED: histone H3.3 [Sesamum indicum] XP_011100034.1 PREDICTED: histone H3.3 [Sesamum indicum] XP_011459532.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] XP_012065514.1 PREDICTED: histone H3.3 [Jatropha curcas] XP_012067913.1 PREDICTED: histone H3.3 [Jatropha curcas] XP_012071983.1 PREDICTED: histone H3.3 [Jatropha curcas] XP_012073854.1 PREDICTED: histone H3.3 [Jatropha curcas] XP_012469821.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012469822.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012469823.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012469824.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012478125.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012445646.1 PREDICTED: histone H3.3 [Gossypium raimondii] XP_012568408.1 PREDICTED: histone H3.3 [Cicer arietinum] XP_012845140.1 PREDICTED: histone H3.3 [Erythranthe guttata] XP_012845141.1 PREDICTED: histone H3.3 [Erythranthe guttata] XP_012856050.1 PREDICTED: histone H3.3 [Erythranthe guttata] XP_013457505.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_013607869.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013607873.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013612488.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013612748.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013629194.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013587978.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013587979.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] XP_013731924.1 PREDICTED: histone H3.3 [Brassica napus] XP_013736360.1 PREDICTED: histone H3.3 [Brassica napus] XP_013678984.1 PREDICTED: histone H3.3 [Brassica napus] XP_013693331.1 PREDICTED: histone H3.3 [Brassica napus] XP_013726329.1 PREDICTED: histone H3.3 [Brassica napus] XP_013648759.1 PREDICTED: histone H3.3 [Brassica napus] XP_013661886.1 PREDICTED: histone H3.3 [Brassica napus] XP_013686983.1 PREDICTED: histone H3.3 [Brassica napus] XP_013729633.1 PREDICTED: histone H3.3 [Brassica napus] XP_014493712.1 PREDICTED: histone H3.3 [Vigna radiata var. radiata] XP_014493713.1 PREDICTED: histone H3.3 [Vigna radiata var. radiata] XP_014504575.1 PREDICTED: histone H3.3 [Vigna radiata var. radiata] XP_014619749.1 PREDICTED: histone H3.3 [Glycine max] XP_014619750.1 PREDICTED: histone H3.3 [Glycine max] XP_015071832.1 PREDICTED: histone H3.3 [Solanum pennellii] XP_015076419.1 PREDICTED: histone H3.3 [Solanum pennellii] XP_015058550.1 PREDICTED: histone H3.3 [Solanum pennellii] XP_015166737.1 PREDICTED: histone H3.3 [Solanum tuberosum] XP_015582307.1 PREDICTED: histone H3.3 [Ricinus communis] XP_015571442.1 PREDICTED: histone H3.3 [Ricinus communis] XP_015630537.1 PREDICTED: histone H3.3 [Oryza sativa Japonica Group] XP_015643543.1 PREDICTED: histone H3.3 [Oryza sativa Japonica Group] XP_015884832.1 PREDICTED: histone H3.3 [Ziziphus jujuba] XP_015885275.1 PREDICTED: histone H3.3 [Ziziphus jujuba] XP_015885276.1 PREDICTED: histone H3.3 [Ziziphus jujuba] XP_015890774.1 PREDICTED: histone H3.3 [Ziziphus jujuba] XP_015964233.1 PREDICTED: histone H3.3 [Arachis duranensis] XP_015964234.1 PREDICTED: histone H3.3 [Arachis duranensis] XP_015969656.1 PREDICTED: histone H3.3 [Arachis duranensis] XP_015933963.1 PREDICTED: histone H3.3 [Arachis duranensis] XP_016201942.1 PREDICTED: histone H3.3 [Arachis ipaensis] XP_016201943.1 PREDICTED: histone H3.3 [Arachis ipaensis] XP_016204771.1 PREDICTED: histone H3.3 [Arachis ipaensis] XP_016167515.1 PREDICTED: histone H3.3 [Arachis ipaensis] XP_016473270.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016480795.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016480796.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016490816.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016493773.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016499793.1 PREDICTED: histone H3.3 [Nicotiana tabacum] XP_016568448.1 PREDICTED: histone H3.3 [Capsicum annuum] XP_016569188.1 PREDICTED: histone H3.3 [Capsicum annuum] XP_016573193.1 PREDICTED: histone H3.3 [Capsicum annuum] XP_016550185.1 PREDICTED: histone H3.3 [Capsicum annuum] XP_016550186.1 PREDICTED: histone H3.3 [Capsicum annuum] XP_016748847.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016687149.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016694168.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016740763.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016740764.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016740765.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016741524.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_016742363.1 PREDICTED: histone H3.3 [Gossypium hirsutum] XP_017228549.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] XP_017230676.1 PREDICTED: histone H3.3 isoform X2 [Daucus carota subsp. sativus] XP_017248172.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] XP_017418256.1 PREDICTED: histone H3.3 [Vigna angularis] XP_017418257.1 PREDICTED: histone H3.3 [Vigna angularis] XP_017430529.1 PREDICTED: histone H3.3 [Vigna angularis] XP_017620403.1 PREDICTED: histone H3.3 [Gossypium arboreum] XP_017623178.1 PREDICTED: histone H3.3 [Gossypium arboreum] XP_017630755.1 PREDICTED: histone H3.3 [Gossypium arboreum] XP_018447173.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018450392.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018468121.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018468122.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018474474.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018474475.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018442730.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018443026.1 PREDICTED: histone H3.3 [Raphanus sativus] XP_018511751.1 PREDICTED: histone H3.3 [Brassica rapa] XP_018623086.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] XP_018833909.1 PREDICTED: histone H3.3 [Juglans regia] XP_018847763.1 PREDICTED: histone H3.3 [Juglans regia] XP_018847764.1 PREDICTED: histone H3.3 [Juglans regia] XP_018849002.1 PREDICTED: histone H3.3 [Juglans regia] XP_018821151.1 PREDICTED: histone H3.3 [Juglans regia] XP_019074729.1 PREDICTED: histone H3.3 [Vitis vinifera] XP_019156140.1 PREDICTED: histone H3.3 [Ipomoea nil] XP_019172343.1 PREDICTED: histone H3.3 [Ipomoea nil] XP_019174535.1 PREDICTED: histone H3.3 [Ipomoea nil] XP_019262398.1 PREDICTED: histone H3.3 [Nicotiana attenuata] XP_019245391.1 PREDICTED: histone H3.3 [Nicotiana attenuata] XP_019245392.1 PREDICTED: histone H3.3 [Nicotiana attenuata] XP_019250044.1 PREDICTED: histone H3.3 [Nicotiana attenuata] XP_019415255.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019416534.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019416535.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019422508.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019422509.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019437643.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019439992.1 PREDICTED: histone H3.3 [Lupinus angustifolius] XP_019702951.1 PREDICTED: histone H3.3 [Elaeis guineensis] XP_020083113.1 histone H3.3 [Ananas comosus] XP_020094996.1 histone H3.3 [Ananas comosus] XP_020101034.1 histone H3.3 [Ananas comosus] XP_020101035.1 histone H3.3 [Ananas comosus] XP_020183056.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020186780.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020187784.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020169776.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020158083.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020158991.1 histone H3.3 [Aegilops tauschii subsp. tauschii] XP_020174561.1 histone H3.3 [Aegilops tauschii subsp. tauschii] P59169.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 Q71V89.3 RecName: Full=Histone H3.3 P69245.2 RecName: Full=Histone H3.3 P69244.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: Full=Minor histone H3 Q71H73.3 RecName: Full=Histone H3.3 Q6RUR1.3 RecName: Full=Histone H3.3 Q71U98.3 RecName: Full=Histone H3.3 Q711T2.3 RecName: Full=Histone H3.3 Q76N23.1 RecName: Full=Histone H3.3 Q3C2E5.3 RecName: Full=Histone H3.3; AltName: Full=Replacement histone H3 A2XHJ3.1 RecName: Full=Histone H3.3; AltName: Full=H3.2 Q0JCT1.2 RecName: Full=Histone H3.3; AltName: Full=H3.2 AAK60325.1 AT4g40030/T5J17_200 [Arabidopsis thaliana] CAA42957.1 histone H3.3 like protein [Arabidopsis thaliana] CAA42958.1 histone H3.3 like protein [Arabidopsis thaliana] AAB49538.1 histone H3.2 [Medicago sativa] AAB36493.1 histone H3.2 [Medicago sativa] AAB36494.1 histone H3.2 [Medicago sativa] AAB36497.1 histone H3.2 [Medicago sativa] AAB36498.1 histone H3.2 [Medicago sativa] CAA56153.1 histone H3 [Lolium temulentum] CAA58445.1 histone H3 variant H3.3 [Solanum lycopersicum] AAB97162.1 histone 3 [Gossypium hirsutum] BAA31218.1 histone H3 [Nicotiana tabacum] AAC78105.1 histone H3 [Oryza sativa Japonica Group] AAC97380.1 histone H3 [Oryza coarctata] CAB38916.1 histone H3.3 [Arabidopsis thaliana] CAB38917.1 Histon H3 [Arabidopsis thaliana] BAA84794.1 histone H3 [Oryza sativa Japonica Group] CAB80666.1 histone H3.3 [Arabidopsis thaliana] CAB80667.1 Histon H3 [Arabidopsis thaliana] CAB96853.1 histon H3 protein [Arabidopsis thaliana] AAL50088.1 AT5g10980/T30N20_250 [Arabidopsis thaliana] AAL77728.1 AT4g40030/T5J17_200 [Arabidopsis thaliana] AAM19891.1 AT5g10980/T30N20_250 [Arabidopsis thaliana] AAM63725.1 histon H3 protein [Arabidopsis thaliana] AAO00751.1 Histon H3 [Arabidopsis thaliana] AAO29945.1 Histone H3 [Arabidopsis thaliana] CAC84678.1 putative histone H3 [Pinus pinaster] AAP30739.1 histone H3.3 [Vitis vinifera] AAR06361.1 histone H3.2 protein [Oryza sativa Japonica Group] AAR84425.1 histone H3-like protein [Capsicum annuum] AAS19511.1 putative histone H3 [Oryza sativa Japonica Group] AAX92697.1 histone 3 [Picea abies] AAZ72655.1 histone H3.1 [Craterostigma plantagineum] AAZ72656.1 histone H3.2 [Craterostigma plantagineum] BAE47073.1 replacement histone H3 [Lolium multiflorum] ABF58917.1 At4g40040 [Arabidopsis thaliana] CAJ38369.1 histin H3 [Plantago major] ABF96358.1 Histone H3, putative, expressed [Oryza sativa Japonica Group] ABF96359.1 Histone H3, putative, expressed [Oryza sativa Japonica Group] BAF12190.1 Os03g0390600 [Oryza sativa Japonica Group] BAF18607.1 Os06g0130900 [Oryza sativa Japonica Group] ABI97039.1 histone H3 [Robinia pseudoacacia] CAH67105.1 H0818E04.22 [Oryza sativa Indica Group] CAH67180.1 H0815C01.1 [Oryza sativa Indica Group] ABK21404.1 unknown [Picea sitchensis] ABK21875.1 unknown [Picea sitchensis] ABK23002.1 unknown [Picea sitchensis] ABK23658.1 unknown [Picea sitchensis] ABK94527.1 unknown [Populus trichocarpa] ABK94627.1 unknown [Populus trichocarpa] ABK94832.1 unknown [Populus trichocarpa] ABK96416.1 unknown [Populus trichocarpa x Populus deltoides] EAY90303.1 hypothetical protein OsI_11878 [Oryza sativa Indica Group] EAZ30915.1 hypothetical protein OsJ_14996 [Oryza sativa Japonica Group] EAZ35710.1 hypothetical protein OsJ_19999 [Oryza sativa Japonica Group] ABP04114.1 histone 3 [Lemna minor] CAN70615.1 hypothetical protein VITISV_004842 [Vitis vinifera] CAN80736.1 hypothetical protein VITISV_034858 [Vitis vinifera] CAN81972.1 hypothetical protein VITISV_011984 [Vitis vinifera] ABR16042.1 unknown [Picea sitchensis] ABR16186.1 unknown [Picea sitchensis] ABR16666.1 unknown [Picea sitchensis] ABR16974.1 unknown [Picea sitchensis] ABR16987.1 unknown [Picea sitchensis] ABR17024.1 unknown [Picea sitchensis] ABR18384.1 unknown [Picea sitchensis] ABS11142.1 histone H3 [Solanum lycopersicum] ABS83501.1 U box domain-containing protein [Oryza sativa Japonica Group] EDQ82911.1 histone H3 [Physcomitrella patens] EDQ82967.1 histone H3 [Physcomitrella patens] EDQ83051.1 histone H3 [Physcomitrella patens] ACA50511.1 histone H3 [Oryza sativa Japonica Group] ACF79815.1 unknown [Zea mays] ACF87291.1 unknown [Zea mays] ACF88473.1 unknown [Zea mays] ACG24535.1 histone H3 [Zea mays] ACG24932.1 histone H3 [Zea mays] ACG25002.1 histone H3 [Zea mays] ACG25605.1 histone H3 [Zea mays] ACG31041.1 histone H3 [Zea mays] ACG31048.1 histone H3 [Zea mays] ACG46136.1 histone H3 [Zea mays] BAG88589.1 unnamed protein product [Oryza sativa Japonica Group] BAG97018.1 unnamed protein product [Oryza sativa Japonica Group] EEC77374.1 hypothetical protein OsI_16104 [Oryza sativa Indica Group] BAH19936.1 AT4G40040 [Arabidopsis thaliana] BAH20155.1 AT4G40040 [Arabidopsis thaliana] EEE59182.1 hypothetical protein OsJ_11116 [Oryza sativa Japonica Group] EEE79999.1 hypothetical protein POPTR_0002s02830g [Populus trichocarpa] EEE90411.1 hypothetical protein POPTR_0007s05050g [Populus trichocarpa] EEE91298.1 hypothetical protein POPTR_0007s13920g [Populus trichocarpa] EEE93290.1 hypothetical protein POPTR_0005s07340g [Populus trichocarpa] EEE94698.1 histone H3-D family protein [Populus trichocarpa] EEF30872.1 histone h3, putative [Ricinus communis] EEF48542.1 histone h3, putative [Ricinus communis] EEF52676.1 histone h3, putative [Ricinus communis] EEF52677.1 histone h3, putative [Ricinus communis] ACN40144.1 unknown [Picea sitchensis] ACN41024.1 unknown [Picea sitchensis] ACN65412.1 histone 3.2 [Pteris vittata] ACR37697.1 unknown [Zea mays] EER89123.1 hypothetical protein SORBI_010G021400 [Sorghum bicolor] EER94758.1 hypothetical protein SORBI_001G350500 [Sorghum bicolor] ACU13139.1 unknown [Glycine max] ADE77894.1 unknown [Picea sitchensis] ADF59039.1 histone H3.2 [Jatropha curcas] EFH49748.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] CBI17398.3 unnamed protein product, partial [Vitis vinifera] CBI33143.3 unnamed protein product, partial [Vitis vinifera] ADI87404.1 histone H3 [Oryza sativa] ADI87405.1 histone H3 [Oryza sativa] ADI87407.1 histone H3 [Oryza sativa] EFJ11992.1 hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] EFJ21130.1 hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] CBI19808.3 unnamed protein product, partial [Vitis vinifera] ADR30795.1 histone H3.2 [Hevea brasiliensis] ADV77197.1 histone H3, partial [Cladophora coelothrix] BAJ86347.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK06635.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ87590.1 predicted protein [Hordeum vulgare subsp. vulgare] AED91617.1 Histone superfamily protein [Arabidopsis thaliana] AEE87155.1 Histone superfamily protein [Arabidopsis thaliana] AEE87157.1 Histone superfamily protein [Arabidopsis thaliana] AEE87158.1 Histone superfamily protein [Arabidopsis thaliana] AEE87159.1 Histone superfamily protein [Arabidopsis thaliana] BAL04972.1 histone H3 [Zoysia japonica] AES59635.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AET03036.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AEZ52395.1 histone H3 [Wolffia australiana] AFC88829.1 histone H23-like protein, partial [Miscanthus sinensis] AFK33416.1 unknown [Lotus japonicus] AFK38785.1 unknown [Medicago truncatula] AFM30053.1 histone H3 [Chimonanthus praecox] AFP44115.1 histone H3 [Lycoris longituba] AFR23066.1 hypothetical protein [Oryza sativa] AFZ93649.1 histone H3 [Euphorbia lathyris] EOA17620.1 hypothetical protein CARUB_v10005986mg [Capsella rubella] EOA17625.1 hypothetical protein CARUB_v10005990mg [Capsella rubella] EOA35876.1 hypothetical protein CARUB_v10021126mg [Capsella rubella] EOX92023.1 Histone superfamily protein [Theobroma cacao] AGN12774.1 histone H3 [Leavenworthia alabamica] AGN12775.1 histone H3 [Leavenworthia alabamica] AGN12782.1 histone H3 [Leavenworthia alabamica] AGN12783.1 histone H3 [Leavenworthia alabamica] AGN12800.1 histone H3 [Leavenworthia alabamica] AGN12801.1 histone H3 [Leavenworthia alabamica] EPS60563.1 hypothetical protein M569_14240 [Genlisea aurea] EPS61796.1 hypothetical protein M569_12997 [Genlisea aurea] AGS80253.1 histone variant H3.3 [Prunus persica] AGS80254.1 histone variant H3.3 [Prunus persica] AGT16456.1 histone H3 [Saccharum hybrid cultivar R570] AGT17152.1 histone H3 [Saccharum hybrid cultivar R570] AGV54183.1 histone H3 [Phaseolus vulgaris] AGW30401.1 histone 3 [Oryza sativa Japonica Group] ERM95413.1 hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda] ERN00651.1 hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda] ERN10859.1 hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda] ERP58201.1 hypothetical protein POPTR_0007s05050g [Populus trichocarpa] ERP60690.1 hypothetical protein POPTR_0005s07340g [Populus trichocarpa] ESQ27575.1 hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum] ESQ41050.1 hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum] ESR39570.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] ESR39571.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] ESR48364.1 hypothetical protein CICLE_v10002817mg [Citrus clementina] ESW32688.1 hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris] ESW35661.1 hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris] EXC04189.1 Histone [Morus notabilis] EYU21874.1 hypothetical protein MIMGU_mgv1a016051mg [Erythranthe guttata] EYU30983.1 hypothetical protein MIMGU_mgv1a016034mg [Erythranthe guttata] KCW54575.1 hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis] KCW54576.1 hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis] KCW67925.1 hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis] KCW67926.1 hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis] AHZ58484.1 histone H3 [Syntrichia caninervis] KDO60693.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] KDO60694.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] KDO60695.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] KDO84768.1 hypothetical protein CISIN_1g032662mg [Citrus sinensis] KDP41416.1 hypothetical protein JCGZ_15823 [Jatropha curcas] KEH31536.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] CDP07429.1 unnamed protein product [Coffea canephora] CDP01510.1 unnamed protein product [Coffea canephora] CDP01921.1 unnamed protein product [Coffea canephora] KFK32443.1 hypothetical protein AALP_AA6G242400 [Arabis alpina] KFK41993.1 hypothetical protein AALP_AA2G198300 [Arabis alpina] CDY69490.1 BnaCnng63830D [Brassica napus] CDY68289.1 BnaAnng26750D [Brassica napus] CDY39044.1 BnaA02g17330D [Brassica napus] CDY13557.1 BnaC02g23680D [Brassica napus] CDX85906.1 BnaC06g22280D [Brassica napus] CDX85735.1 BnaA02g00780D [Brassica napus] CDX78406.1 BnaA03g03180D [Brassica napus] CDX70375.1 BnaC03g04590D [Brassica napus] CDX69362.1 BnaC01g00910D [Brassica napus] CDX68121.1 BnaA07g21610D [Brassica napus] KGN62710.1 hypothetical protein Csa_2G369110 [Cucumis sativus] KHG29682.1 Histone H3.3 [Gossypium arboreum] KHL91128.1 hypothetical protein QW71_36435 [Paenibacillus sp. IHB B 3415] KHN12662.1 Histone H3.3 [Glycine soja] KHN31393.1 Histone H3.3 [Glycine soja] KHN44355.1 Histone H3.3 [Glycine soja] KHN44356.1 Histone H3.3 [Glycine soja] KJB17321.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17322.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17323.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17324.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17325.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17326.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB17328.1 hypothetical protein B456_003G041300 [Gossypium raimondii] KJB27557.1 hypothetical protein B456_005G111200 [Gossypium raimondii] KJB27558.1 hypothetical protein B456_005G111200 [Gossypium raimondii] KJB27559.1 hypothetical protein B456_005G111200 [Gossypium raimondii] KJB58990.1 hypothetical protein B456_009G234200 [Gossypium raimondii] KMT09530.1 hypothetical protein BVRB_6g129930 [Beta vulgaris subsp. vulgaris] AKR53658.1 histone H3 [Oxytropis ochrocephala] KMZ66600.1 histone H3 [Zostera marina] KMZ71974.1 histone H3 [Zostera marina] KNA09738.1 hypothetical protein SOVF_150870 [Spinacia oleracea] KNA22068.1 hypothetical protein SOVF_037400 [Spinacia oleracea] BAS30508.1 histone H3-1 [Pyramimonas parkeae] BAS84518.1 Os03g0390600 [Oryza sativa Japonica Group] KQJ82897.1 hypothetical protein BRADI_5g11920 [Brachypodium distachyon] KQK19721.1 hypothetical protein BRADI_1g49997 [Brachypodium distachyon] KQK90581.1 hypothetical protein SETIT_037975mg [Setaria italica] KQK97507.1 hypothetical protein SETIT_011282mg [Setaria italica] KRG97549.1 hypothetical protein GLYMA_18G015300 [Glycine max] KRH17395.1 hypothetical protein GLYMA_14G217100 [Glycine max] KRH31323.1 hypothetical protein GLYMA_11G241800 [Glycine max] KRX12280.1 histone H3.3 [Trichinella nelsoni] BAT82801.1 hypothetical protein VIGAN_03286800 [Vigna angularis var. angularis] BAT86539.1 hypothetical protein VIGAN_04420500 [Vigna angularis var. angularis] BAT86540.1 hypothetical protein VIGAN_04420600 [Vigna angularis var. angularis] CUT18456.1 H3.3 [Lilium davidii var. unicolor] KVH98548.1 Histone core [Cynara cardunculus var. scolymus] KVI06500.1 Histone core [Cynara cardunculus var. scolymus] KXG26431.1 hypothetical protein SORBI_006G100600 [Sorghum bicolor] KXG26432.1 hypothetical protein SORBI_006G100600 [Sorghum bicolor] KYP46593.1 Histone H3.3 [Cajanus cajan] KYP75772.1 Histone H3.3 [Cajanus cajan] KYP75774.1 Histone H3.3 [Cajanus cajan] KZN10814.1 hypothetical protein DCAR_003470 [Daucus carota subsp. sativus] KZV30103.1 hypothetical protein F511_19646 [Dorcoceras hygrometricum] KZV39839.1 hypothetical protein F511_15319 [Dorcoceras hygrometricum] KZV49786.1 hypothetical protein F511_07337 [Dorcoceras hygrometricum] KZV50471.1 hypothetical protein F511_34915 [Dorcoceras hygrometricum] OAE23194.1 hypothetical protein AXG93_1630s1090 [Marchantia polymorpha subsp. polymorpha] OAE34801.1 hypothetical protein AXG93_2528s1670 [Marchantia polymorpha subsp. polymorpha] OAO94064.1 hypothetical protein AXX17_AT5G10660 [Arabidopsis thaliana] OAO97196.1 hypothetical protein AXX17_AT4G45480 [Arabidopsis thaliana] OAO97921.1 hypothetical protein AXX17_AT4G45470 [Arabidopsis thaliana] OAY23263.1 hypothetical protein MANES_18G064500 [Manihot esculenta] OAY23264.1 hypothetical protein MANES_18G064500 [Manihot esculenta] OAY57511.1 hypothetical protein MANES_02G102400 [Manihot esculenta] OAY57512.1 hypothetical protein MANES_02G102400 [Manihot esculenta] OAY62725.1 histone H3.3 [Ananas comosus] OAY69904.1 histone H3.3 [Ananas comosus] OAY78118.1 histone H3.3 [Ananas comosus] ANM66215.1 Histone superfamily protein [Arabidopsis thaliana] ANM67333.1 Histone superfamily protein [Arabidopsis thaliana] ANS54494.1 histone H3 [Brassica rapa subsp. chinensis] GAU45109.1 hypothetical protein TSUD_183170 [Trifolium subterraneum] GAU41101.1 hypothetical protein TSUD_139700 [Trifolium subterraneum] JAT50553.1 Histone H3.3 [Anthurium amnicola] OIC47138.1 hypothetical protein A7L55_20660 [Acinetobacter baumannii] OIC50312.1 hypothetical protein A7L55_19925 [Acinetobacter baumannii] JAU14756.1 Histone H3.3 [Noccaea caerulescens] JAU20095.1 Histone H3.3 [Noccaea caerulescens] JAU32412.1 Histone H3.3 [Noccaea caerulescens] JAU38683.1 Histone H3.3 [Noccaea caerulescens] JAU56732.1 Histone H3.3 [Noccaea caerulescens] JAU62792.1 Histone H3.3 [Noccaea caerulescens] JAU84128.1 Histone H3.3 [Noccaea caerulescens] JAU86589.1 Histone H3.3 [Noccaea caerulescens] JAU98513.1 Histone H3.3 [Noccaea caerulescens] OIT00704.1 histone h3.3 [Nicotiana attenuata] OIT03084.1 histone h3.3 [Nicotiana attenuata] OIT37833.1 histone h3.3 [Nicotiana attenuata] OIV92691.1 hypothetical protein TanjilG_18042 [Lupinus angustifolius] OIW15037.1 hypothetical protein TanjilG_13964 [Lupinus angustifolius] GAV81461.1 Histone domain-containing protein [Cephalotus follicularis] GAV79343.1 Histone domain-containing protein, partial [Cephalotus follicularis] GAV79346.1 Histone domain-containing protein, partial [Cephalotus follicularis] OMO56148.1 histone H3 [Corchorus capsularis] OMO75311.1 histone H3 [Corchorus olitorius] OMO87447.1 histone H3 [Corchorus capsularis] OMO94489.1 histone H3 [Corchorus capsularis] OMP01270.1 histone H3 [Corchorus olitorius] ONI02347.1 hypothetical protein PRUPE_6G192700 [Prunus persica] ONI32468.1 hypothetical protein PRUPE_1G369600 [Prunus persica] ONI35204.1 hypothetical protein PRUPE_1G522300 [Prunus persica] ONI35205.1 hypothetical protein PRUPE_1G522300 [Prunus persica] AQA28697.1 histone 3 [Hibiscus cannabinus] ONL98646.1 Histone H3 [Zea mays] ONL98647.1 Histone H3 [Zea mays] ONL98649.1 Histone H3 [Zea mays] AQK71917.1 Histone H3 [Zea mays] AQK71918.1 Histone H3 [Zea mays] AQK71919.1 Histone H3 [Zea mays] AQK71920.1 Histone H3 [Zea mays] AQK71921.1 Histone H3 [Zea mays] AQK71922.1 Histone H3 [Zea mays] AQK80197.1 Histone H3 [Zea mays] AQL02337.1 Histone H3 [Zea mays] Length = 136 Score = 246 bits (627), Expect = 7e-81 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >CAN70652.1 hypothetical protein VITISV_010022 [Vitis vinifera] Length = 137 Score = 246 bits (627), Expect = 7e-81 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 13 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 72 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 73 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 132 Query: 361 RGERA 375 RGERA Sbjct: 133 RGERA 137 >CBI23573.3 unnamed protein product, partial [Vitis vinifera] Length = 147 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 23 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 82 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 83 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 142 Query: 361 RGERA 375 RGERA Sbjct: 143 RGERA 147 >GAV83258.1 Histone domain-containing protein, partial [Cephalotus follicularis] Length = 148 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 24 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 83 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 84 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 143 Query: 361 RGERA 375 RGERA Sbjct: 144 RGERA 148 >KXG30479.1 hypothetical protein SORBI_004G188000 [Sorghum bicolor] Length = 149 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 25 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 84 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 85 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 144 Query: 361 RGERA 375 RGERA Sbjct: 145 RGERA 149 >EMT02210.1 Histone H3.3 [Aegilops tauschii] Length = 150 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 26 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 85 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 86 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 145 Query: 361 RGERA 375 RGERA Sbjct: 146 RGERA 150 >KJB17320.1 hypothetical protein B456_003G041300 [Gossypium raimondii] Length = 153 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 29 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 88 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 89 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 148 Query: 361 RGERA 375 RGERA Sbjct: 149 RGERA 153 >XP_017230674.1 PREDICTED: histone H3.3 isoform X1 [Daucus carota subsp. sativus] Length = 154 Score = 246 bits (627), Expect = 1e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 30 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 89 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 90 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 149 Query: 361 RGERA 375 RGERA Sbjct: 150 RGERA 154 >XP_010106281.1 Histone [Morus notabilis] EXC09698.1 Histone [Morus notabilis] Length = 159 Score = 246 bits (627), Expect = 2e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 35 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 94 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 95 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 154 Query: 361 RGERA 375 RGERA Sbjct: 155 RGERA 159 >NP_001078516.1 Histone superfamily protein [Arabidopsis thaliana] AEE87156.1 Histone superfamily protein [Arabidopsis thaliana] Length = 164 Score = 246 bits (627), Expect = 2e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 40 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 99 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 100 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 159 Query: 361 RGERA 375 RGERA Sbjct: 160 RGERA 164 >KQK19720.1 hypothetical protein BRADI_1g49990, partial [Brachypodium distachyon] Length = 165 Score = 246 bits (627), Expect = 2e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 41 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 100 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 101 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 160 Query: 361 RGERA 375 RGERA Sbjct: 161 RGERA 165 >GAQ89306.1 Histones H3 and H4 [Klebsormidium flaccidum] Length = 136 Score = 244 bits (624), Expect = 2e-80 Identities = 124/125 (99%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >ACG48841.1 histone H3 [Zea mays] Length = 136 Score = 244 bits (624), Expect = 2e-80 Identities = 124/125 (99%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQK+TELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKNTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >NP_001281232.1 60S ribosomal protein L32 [Zea mays] XP_013447192.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_019579020.1 PREDICTED: histone H3.3 [Rhinolophus sinicus] XP_019579042.1 PREDICTED: histone H3.3 [Rhinolophus sinicus] ACG27450.1 histone H3 [Zea mays] ACG31205.1 histone H3 [Zea mays] AFK42091.1 unknown [Medicago truncatula] KEH21219.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] ONM17035.1 ribosomal protein L32 homolog32 [Zea mays] ONM17036.1 ribosomal protein L32 homolog32 [Zea mays] Length = 136 Score = 244 bits (624), Expect = 2e-80 Identities = 124/125 (99%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKST+LLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTDLLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >XP_006425525.1 hypothetical protein CICLE_v10026741mg [Citrus clementina] XP_006466922.1 PREDICTED: histone H3.3 [Citrus sinensis] XP_016696922.1 PREDICTED: histone H3.3-like [Gossypium hirsutum] XP_017627466.1 PREDICTED: histone H3.3-like [Gossypium arboreum] EOX90891.1 Histone superfamily protein [Theobroma cacao] ESR38765.1 hypothetical protein CICLE_v10026741mg [Citrus clementina] KDO71133.1 hypothetical protein CISIN_1g032654mg [Citrus sinensis] KDO71134.1 hypothetical protein CISIN_1g032654mg [Citrus sinensis] GAV75882.1 Histone domain-containing protein [Cephalotus follicularis] Length = 136 Score = 244 bits (624), Expect = 2e-80 Identities = 124/125 (99%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+RVTIMPKDIQLARRI Sbjct: 72 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >XP_002985522.1 hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii] XP_002987048.1 hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii] XP_007018714.1 PREDICTED: histone H3.3 [Theobroma cacao] EFJ11891.1 hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii] EFJ13396.1 hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii] EOY15939.1 Histone superfamily protein [Theobroma cacao] Length = 136 Score = 244 bits (624), Expect = 2e-80 Identities = 124/125 (99%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 12 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 71 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 72 VREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131 Query: 361 RGERA 375 RGERA Sbjct: 132 RGERA 136 >BAS95979.1 Os06g0130900, partial [Oryza sativa Japonica Group] Length = 169 Score = 246 bits (627), Expect = 2e-80 Identities = 125/125 (100%), Positives = 125/125 (100%) Frame = +1 Query: 1 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 180 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL Sbjct: 45 TGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL 104 Query: 181 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 360 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI Sbjct: 105 VREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 164 Query: 361 RGERA 375 RGERA Sbjct: 165 RGERA 169