BLASTX nr result
ID: Glycyrrhiza35_contig00005993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00005993 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003627676.1 cytochrome P450 family protein [Medicago truncatu... 100 1e-22 XP_013445324.1 cytochrome P450 family protein [Medicago truncatu... 97 7e-22 XP_012573461.1 PREDICTED: cytochrome P450 704C1-like isoform X1 ... 97 4e-21 XP_004508543.1 PREDICTED: cytochrome P450 704C1-like isoform X2 ... 97 4e-21 XP_003627673.1 cytochrome P450 family protein [Medicago truncatu... 96 1e-20 KHN04571.1 Cytochrome P450 704C1 [Glycine soja] 91 1e-20 XP_007134454.1 hypothetical protein PHAVU_010G048700g [Phaseolus... 95 1e-20 XP_006576393.1 PREDICTED: cytochrome P450 704C1-like [Glycine ma... 95 1e-20 XP_013445000.1 cytochrome P450 family protein [Medicago truncatu... 93 4e-20 XP_013445001.1 cytochrome P450 family protein [Medicago truncatu... 93 6e-20 XP_003521549.1 PREDICTED: cytochrome P450 704C1 [Glycine max] KR... 93 7e-20 XP_003627672.1 cytochrome P450 family protein [Medicago truncatu... 93 7e-20 XP_014522450.1 PREDICTED: cytochrome P450 704C1-like [Vigna radi... 92 1e-19 XP_017429429.1 PREDICTED: cytochrome P450 704C1 [Vigna angularis... 92 2e-19 XP_014506352.1 PREDICTED: cytochrome P450 704C1-like [Vigna radi... 92 2e-19 BAT97784.1 hypothetical protein VIGAN_09133200 [Vigna angularis ... 92 2e-19 KHN04093.1 Cytochrome P450 704C1 [Glycine soja] 92 2e-19 KHN04083.1 Cytochrome P450 704C1 [Glycine soja] 90 1e-18 KRH48345.1 hypothetical protein GLYMA_07G083400 [Glycine max] 89 2e-18 KOM47920.1 hypothetical protein LR48_Vigan07g162400 [Vigna angul... 87 1e-17 >XP_003627676.1 cytochrome P450 family protein [Medicago truncatula] AET02152.1 cytochrome P450 family protein [Medicago truncatula] Length = 510 Score = 100 bits (250), Expect = 1e-22 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 +A+CFIMM TIF GKSI DP+YAPVKGTVF+QLF FK+LHDYHAQLAK+HPT RLLAP+Q Sbjct: 20 LAICFIMM-TIFKGKSIGDPKYAPVKGTVFNQLFNFKKLHDYHAQLAKTHPTMRLLAPNQ 78 >XP_013445324.1 cytochrome P450 family protein [Medicago truncatula] KEH19350.1 cytochrome P450 family protein [Medicago truncatula] Length = 307 Score = 96.7 bits (239), Expect = 7e-22 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +3 Query: 183 MTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 MTIF GKSI DP+YAPVKGTVF+QLFYFK+LHDYHAQLAK+HPT RLLAP+Q Sbjct: 1 MTIFKGKSIGDPKYAPVKGTVFNQLFYFKKLHDYHAQLAKTHPTMRLLAPNQ 52 >XP_012573461.1 PREDICTED: cytochrome P450 704C1-like isoform X1 [Cicer arietinum] Length = 511 Score = 96.7 bits (239), Expect = 4e-21 Identities = 44/57 (77%), Positives = 54/57 (94%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLA 329 +A+CFIM++ IF GKSI DP+YAPVKGTVF+QLFYFK+LHDYHAQ+AK+HPT+RLLA Sbjct: 20 LAICFIMII-IFKGKSIGDPKYAPVKGTVFNQLFYFKKLHDYHAQMAKTHPTYRLLA 75 >XP_004508543.1 PREDICTED: cytochrome P450 704C1-like isoform X2 [Cicer arietinum] Length = 511 Score = 96.7 bits (239), Expect = 4e-21 Identities = 44/57 (77%), Positives = 54/57 (94%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLA 329 +A+CFIM++ IF GKSI DP+YAPVKGTVF+QLFYFK+LHDYHAQ+AK+HPT+RLLA Sbjct: 20 LAICFIMII-IFKGKSIGDPKYAPVKGTVFNQLFYFKKLHDYHAQMAKTHPTYRLLA 75 >XP_003627673.1 cytochrome P450 family protein [Medicago truncatula] AET02149.1 cytochrome P450 family protein [Medicago truncatula] Length = 510 Score = 95.5 bits (236), Expect = 1e-20 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPD 335 +A+CFIMM TIF GKSI D +Y PVKGTVF+QLFYFK+L+DYHAQLAK HPT+RLLAP+ Sbjct: 20 LAICFIMM-TIFKGKSIGDSKYTPVKGTVFNQLFYFKKLYDYHAQLAKIHPTYRLLAPN 77 >KHN04571.1 Cytochrome P450 704C1 [Glycine soja] Length = 185 Score = 90.9 bits (224), Expect = 1e-20 Identities = 42/60 (70%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFI++ TI +GKSI DP+YAPVKGTVF+QL YF LHDY AQ+AK++PTFRLLAPDQ Sbjct: 20 LVFCFILLSTI-LGKSIGDPDYAPVKGTVFNQLLYFNTLHDYQAQVAKTNPTFRLLAPDQ 78 >XP_007134454.1 hypothetical protein PHAVU_010G048700g [Phaseolus vulgaris] ESW06448.1 hypothetical protein PHAVU_010G048700g [Phaseolus vulgaris] Length = 509 Score = 95.1 bits (235), Expect = 1e-20 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CF+ + T+ +GKSI DP+YAPVKGTVF+QLFYF LHDYHA++AK+HPTFRLLAPDQ Sbjct: 20 LVFCFLTL-TMILGKSIGDPDYAPVKGTVFNQLFYFNTLHDYHAEVAKTHPTFRLLAPDQ 78 >XP_006576393.1 PREDICTED: cytochrome P450 704C1-like [Glycine max] KRH65206.1 hypothetical protein GLYMA_03G020400 [Glycine max] Length = 511 Score = 95.1 bits (235), Expect = 1e-20 Identities = 44/60 (73%), Positives = 52/60 (86%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QL YF LHDYHAQ+AK++PTFRLLAPDQ Sbjct: 20 LVFCFIML-TIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYHAQVAKTNPTFRLLAPDQ 78 >XP_013445000.1 cytochrome P450 family protein [Medicago truncatula] KEH19025.1 cytochrome P450 family protein [Medicago truncatula] Length = 395 Score = 93.2 bits (230), Expect = 4e-20 Identities = 43/60 (71%), Positives = 53/60 (88%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 +A+CFI+M TIF GKSI DP+YAPVKGTVF+ LFYF +L+DY AQ+AK HPT+RLLAP+Q Sbjct: 20 LAICFILM-TIFKGKSIGDPKYAPVKGTVFNHLFYFNKLYDYQAQMAKIHPTYRLLAPNQ 78 >XP_013445001.1 cytochrome P450 family protein [Medicago truncatula] KEH19026.1 cytochrome P450 family protein [Medicago truncatula] Length = 459 Score = 93.2 bits (230), Expect = 6e-20 Identities = 43/60 (71%), Positives = 53/60 (88%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 +A+CFI+M TIF GKSI DP+YAPVKGTVF+ LFYF +L+DY AQ+AK HPT+RLLAP+Q Sbjct: 20 LAICFILM-TIFKGKSIGDPKYAPVKGTVFNHLFYFNKLYDYQAQMAKIHPTYRLLAPNQ 78 >XP_003521549.1 PREDICTED: cytochrome P450 704C1 [Glycine max] KRH65235.1 hypothetical protein GLYMA_03G021600 [Glycine max] Length = 511 Score = 93.2 bits (230), Expect = 7e-20 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QL YF LHDY AQLAK++PTFRLLAPDQ Sbjct: 20 LVFCFIML-TIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYQAQLAKTNPTFRLLAPDQ 78 >XP_003627672.1 cytochrome P450 family protein [Medicago truncatula] AET02148.1 cytochrome P450 family protein [Medicago truncatula] Length = 511 Score = 93.2 bits (230), Expect = 7e-20 Identities = 43/60 (71%), Positives = 53/60 (88%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 +A+CFI+M TIF GKSI DP+YAPVKGTVF+ LFYF +L+DY AQ+AK HPT+RLLAP+Q Sbjct: 20 LAICFILM-TIFKGKSIGDPKYAPVKGTVFNHLFYFNKLYDYQAQMAKIHPTYRLLAPNQ 78 >XP_014522450.1 PREDICTED: cytochrome P450 704C1-like [Vigna radiata var. radiata] Length = 509 Score = 92.4 bits (228), Expect = 1e-19 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QLFYF LHDY A++AK+ PTFRLLAPDQ Sbjct: 20 LVFCFIMLTTI-LGKSIGDPDYAPVKGTVFNQLFYFNRLHDYQAEMAKTIPTFRLLAPDQ 78 >XP_017429429.1 PREDICTED: cytochrome P450 704C1 [Vigna angularis] XP_017429430.1 PREDICTED: cytochrome P450 704C1 [Vigna angularis] Length = 509 Score = 92.0 bits (227), Expect = 2e-19 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QLFYF LHDY A++AK+ PTFRLLAPDQ Sbjct: 20 LVFCFIMLTTI-LGKSIGDPDYAPVKGTVFNQLFYFNTLHDYQAEMAKTIPTFRLLAPDQ 78 >XP_014506352.1 PREDICTED: cytochrome P450 704C1-like [Vigna radiata var. radiata] Length = 517 Score = 92.0 bits (227), Expect = 2e-19 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QLFYF LHDY A++AK+ PTFRLLAPDQ Sbjct: 20 LVFCFIMLTTI-LGKSIGDPDYAPVKGTVFNQLFYFNTLHDYQAEMAKTIPTFRLLAPDQ 78 >BAT97784.1 hypothetical protein VIGAN_09133200 [Vigna angularis var. angularis] Length = 520 Score = 92.0 bits (227), Expect = 2e-19 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFIM+ TI +GKSI DP+YAPVKGTVF+QLFYF LHDY A++AK+ PTFRLLAPDQ Sbjct: 20 LVFCFIMLTTI-LGKSIGDPDYAPVKGTVFNQLFYFNTLHDYQAEMAKTIPTFRLLAPDQ 78 >KHN04093.1 Cytochrome P450 704C1 [Glycine soja] Length = 497 Score = 91.7 bits (226), Expect = 2e-19 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +3 Query: 180 MMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 M+TI +GKSI DP+YAPVKGTVF+QL YF LHDYHAQ+AK++PTFRLLAPDQ Sbjct: 1 MLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYHAQVAKTNPTFRLLAPDQ 53 >KHN04083.1 Cytochrome P450 704C1 [Glycine soja] Length = 486 Score = 89.7 bits (221), Expect = 1e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +3 Query: 180 MMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 M+TI +GKSI DP+YAPVKGTVF+QL YF LHDY AQLAK++PTFRLLAPDQ Sbjct: 1 MLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYQAQLAKTNPTFRLLAPDQ 53 >KRH48345.1 hypothetical protein GLYMA_07G083400 [Glycine max] Length = 467 Score = 89.0 bits (219), Expect = 2e-18 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +3 Query: 159 MALCFIMMMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 + CFI++ TI +GKSI DP+YAPVKGTVF+QL +F LHDY AQ+AK++PTFRLLAPDQ Sbjct: 20 LVFCFILLSTI-LGKSIGDPDYAPVKGTVFNQLLHFNTLHDYQAQVAKTNPTFRLLAPDQ 78 >KOM47920.1 hypothetical protein LR48_Vigan07g162400 [Vigna angularis] Length = 484 Score = 87.0 bits (214), Expect = 1e-17 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +3 Query: 180 MMTIFMGKSIWDPEYAPVKGTVFHQLFYFKELHDYHAQLAKSHPTFRLLAPDQ 338 M+T +GKSI DP+YAPVKGTVF+QLFYF LHDY A++AK+ PTFRLLAPDQ Sbjct: 1 MLTTILGKSIGDPDYAPVKGTVFNQLFYFNTLHDYQAEMAKTIPTFRLLAPDQ 53