BLASTX nr result
ID: Glycyrrhiza35_contig00004813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00004813 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OGM78425.1 hypothetical protein A2197_02960 [Candidatus Woesebac... 60 3e-10 EZY42791.1 hypothetical protein V052_02628, partial [Staphylococ... 59 8e-10 ADI17229.1 hypothetical protein, partial [uncultured alpha prote... 61 9e-10 OGY07486.1 hypothetical protein A2694_04450 [Candidatus Blackbur... 60 9e-10 EFD76993.1 LOW QUALITY PROTEIN: predicted protein, partial [Myco... 56 2e-08 WP_026390740.1 hypothetical protein [Acholeplasma axanthum] 55 2e-08 ABR26094.1 retrotransposon protein [Oryza sativa Indica Group] 56 4e-08 BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multiv... 55 8e-08 AID23550.1 hypothetical protein, partial [Phaeodactylum tricornu... 54 1e-07 EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter j... 53 2e-07 EUT77524.1 hypothetical protein O310_02010, partial [Staphylococ... 53 2e-07 OGM73289.1 hypothetical protein A2185_01740 [Candidatus Woesebac... 53 2e-07 ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanic... 54 3e-07 KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulga... 53 3e-07 CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella as... 52 4e-07 KAE34487.1 hypothetical protein W610_02615, partial [Staphylococ... 52 7e-07 CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] 50 1e-06 KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] 54 2e-06 ADI18654.1 hypothetical protein [uncultured Acidobacteria bacter... 49 3e-06 EGG54195.1 hypothetical protein HMPREF9439_01522 [Parasutterella... 49 7e-06 >OGM78425.1 hypothetical protein A2197_02960 [Candidatus Woesebacteria bacterium RIFOXYA1_FULL_48_16] OGM83412.1 hypothetical protein A2376_02965 [Candidatus Woesebacteria bacterium RIFOXYB1_FULL_47_31] Length = 73 Score = 60.5 bits (145), Expect = 3e-10 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -2 Query: 141 RGKQP*PTAKAPNSWLSGKGCGTPKTTRRLA*KQPSFKESVTAHWS 4 RGK P +AKA S LS KG PKT RRLA KQP FKESVTAHWS Sbjct: 3 RGKHPRLSAKASKSILSLKGSSFPKTARRLAQKQPPFKESVTAHWS 48 >EZY42791.1 hypothetical protein V052_02628, partial [Staphylococcus aureus MSSA-93] EZY42792.1 hypothetical protein V052_02627, partial [Staphylococcus aureus MSSA-93] Length = 74 Score = 59.3 bits (142), Expect = 8e-10 Identities = 31/56 (55%), Positives = 34/56 (60%) Frame = +2 Query: 50 ANLLVVLGVPHPFPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLPGIRSLVGFG 217 AN+LVV PHPFPL+ G LA G GCFP G HP S+ L GIRSL FG Sbjct: 1 ANILVVWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFG 56 >ADI17229.1 hypothetical protein, partial [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 60.8 bits (146), Expect = 9e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 7 PVSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 PVS YAFFKGWLLLSQPPGC G PTSFPT Sbjct: 111 PVSYYAFFKGWLLLSQPPGCLGLPTSFPT 139 >OGY07486.1 hypothetical protein A2694_04450 [Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_01_FULL_40_17] OGY08829.1 hypothetical protein A3D24_03150 [Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_02_FULL_39_13] Length = 109 Score = 60.1 bits (144), Expect = 9e-10 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -2 Query: 141 RGKQP*PTAKAPNSWLSGKGCGTPKTTRRLA*KQPSFKESVTAHWSS 1 +GKQP + KA WLS KG P+T RRLA KQPSFKESV AHWS+ Sbjct: 3 KGKQPRLSVKASKFWLSCKGSYYPQTPRRLAQKQPSFKESVIAHWST 49 >EFD76993.1 LOW QUALITY PROTEIN: predicted protein, partial [Mycobacterium tuberculosis T85] Length = 68 Score = 55.8 bits (133), Expect = 2e-08 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +3 Query: 3 LTSELLRFL*RMAASKPTSWLFWESHILSHLATNWGP 113 LTSELLR L R+AASKPTSWL HILSHLA WGP Sbjct: 32 LTSELLRTLSRVAASKPTSWLSLRLHILSHLAHAWGP 68 >WP_026390740.1 hypothetical protein [Acholeplasma axanthum] Length = 74 Score = 55.5 bits (132), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 233 GGPKPYQTQPNSEYLGVLLGRHTAGANVRRGEGNNPDLQLRPPIRG*VGKDVGLPKQPGG 54 G Y TQ N E + T G V +GN+PD QLR V K+V + KQ GG Sbjct: 4 GPTSGYWTQLNFECHKSEISSQTVGDKVHGQKGNSPDRQLRSQNSCWVEKEVEMHKQLGG 63 Query: 53 WLRSSHPLKKA 21 WLRSSHPLK A Sbjct: 64 WLRSSHPLKSA 74 >ABR26094.1 retrotransposon protein [Oryza sativa Indica Group] Length = 109 Score = 55.8 bits (133), Expect = 4e-08 Identities = 31/64 (48%), Positives = 39/64 (60%) Frame = -3 Query: 212 TQPNSEYLGVLLGRHTAGANVRRGEGNNPDLQLRPPIRG*VGKDVGLPKQPGGWLRSSHP 33 T+ + + GV T G + R EGN+PD QLRP V K+VG+ +QPGG RSSHP Sbjct: 46 TRYDPKITGVRSASETMGDKLHRREGNSPDHQLRPLNDRSVIKEVGVQRQPGGLPRSSHP 105 Query: 32 LKKA 21 LK A Sbjct: 106 LKSA 109 >BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] Length = 123 Score = 55.5 bits (132), Expect = 8e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +1 Query: 10 VSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 VS YAFFKGWLLLSQPP CF PTSFPT Sbjct: 96 VSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 >AID23550.1 hypothetical protein, partial [Phaeodactylum tricornutum] Length = 73 Score = 53.5 bits (127), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +1 Query: 10 VSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 VS YAFFKGWLLLSQPP C PTSFPT Sbjct: 46 VSYYAFFKGWLLLSQPPSCLSLPTSFPT 73 >EFC30233.1 hypothetical protein C1336_000600005 [Campylobacter jejuni subsp. jejuni 1336] Length = 51 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 1 T*PVSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 T PVS YAFFKGWLLLSQPPGC + TSF T Sbjct: 21 TRPVSYYAFFKGWLLLSQPPGCLSNFTSFST 51 >EUT77524.1 hypothetical protein O310_02010, partial [Staphylococcus aureus M0125] EVA80172.1 hypothetical protein O597_00904, partial [Staphylococcus aureus M0549] Length = 70 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = +2 Query: 62 VVLGVPHPFPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLPGIRSLVGFG 217 VV PHPFPL+ G LA G GCFP G HP S+ L GIRSL FG Sbjct: 1 VVWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFG 52 >OGM73289.1 hypothetical protein A2185_01740 [Candidatus Woesebacteria bacterium RIFOXYA1_FULL_31_71] OGM82246.1 hypothetical protein A2422_00205 [Candidatus Woesebacteria bacterium RIFOXYC1_FULL_31_51] Length = 61 Score = 52.8 bits (125), Expect = 2e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 141 RGKQP*PTAKAPNSWLSGKGCGTPKTTRRLA*KQPSFKESVTAHWSS 1 +GK P +AKA S LS KG +T RRLA KQP FK+SVTAHWS+ Sbjct: 3 KGKHPRFSAKASKSTLSLKGSFFSQTARRLAQKQPPFKDSVTAHWST 49 >ELY20072.1 hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1] Length = 98 Score = 53.5 bits (127), Expect = 3e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +1 Query: 10 VSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 VS YAFFKGWLLLSQPP C PTSFPT Sbjct: 71 VSYYAFFKGWLLLSQPPSCLSLPTSFPT 98 >KMS93274.1 hypothetical protein BVRB_033130, partial [Beta vulgaris subsp. vulgaris] Length = 79 Score = 52.8 bits (125), Expect = 3e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +1 Query: 1 T*PVSCYAFFKGWLLLSQPPGCFGSPTSFP 90 T PVS YAFFKGWLLLSQPPGC TSFP Sbjct: 50 TRPVSYYAFFKGWLLLSQPPGCLCLSTSFP 79 >CCG20229.1 hypothetical protein KUM_1451, partial [Taylorella asinigenitalis 14/45] Length = 53 Score = 52.0 bits (123), Expect = 4e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +1 Query: 10 VSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 VS YAFFKGWLLLSQPP C PTSFPT Sbjct: 26 VSYYAFFKGWLLLSQPPDCLCLPTSFPT 53 >KAE34487.1 hypothetical protein W610_02615, partial [Staphylococcus aureus VET0363R] KAE36074.1 hypothetical protein W610_02168, partial [Staphylococcus aureus VET0363R] KAE39600.1 hypothetical protein W610_00790, partial [Staphylococcus aureus VET0363R] Length = 69 Score = 51.6 bits (122), Expect = 7e-07 Identities = 27/51 (52%), Positives = 29/51 (56%) Frame = +2 Query: 65 VLGVPHPFPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLPGIRSLVGFG 217 V PHPFPL+ G LA G GCFP G HP S+ L GIRSL FG Sbjct: 1 VWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFG 51 >CDN41082.1 Putative uncharacterized protein [Paenibacillus sp. P22] Length = 51 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +1 Query: 1 T*PVSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 T PVS YA FK WLLLSQ PGC G+ TSFPT Sbjct: 21 TRPVSYYALFKWWLLLSQHPGCLGNSTSFPT 51 >KRH38400.1 hypothetical protein GLYMA_09G133900 [Glycine max] Length = 345 Score = 53.9 bits (128), Expect = 2e-06 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 10 VSCYAFFKGWLLLSQPPGCFGSPTSFPT*PRIGGLSC-RSGLFPSPRRTLAPAVCLPSST 186 VS YAFF+GWLLL +PPGC +PTSF T GLSC R L P AP C T Sbjct: 251 VSYYAFFQGWLLLGKPPGCLCTPTSFITERSFRGLSCIRVCLDLVPLSWPAPKQCF---T 307 Query: 187 PR 192 PR Sbjct: 308 PR 309 >ADI18654.1 hypothetical protein [uncultured Acidobacteria bacterium HF4000_26D02] Length = 45 Score = 49.3 bits (116), Expect = 3e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +3 Query: 3 LTSELLRFL*RMAASKPTSWLFWESHILSHLA 98 LTSELLRFL RMAASKPTSWL ILSHLA Sbjct: 12 LTSELLRFLSRMAASKPTSWLSRRFQILSHLA 43 >EGG54195.1 hypothetical protein HMPREF9439_01522 [Parasutterella excrementihominis YIT 11859] Length = 75 Score = 49.3 bits (116), Expect = 7e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +1 Query: 1 T*PVSCYAFFKGWLLLSQPPGCFGSPTSFPT 93 T PVS YAFF+GWLLLSQ PGC G TSF T Sbjct: 45 TRPVSYYAFFEGWLLLSQLPGCHGLSTSFST 75