BLASTX nr result
ID: Glycyrrhiza35_contig00004709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00004709 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH43847.1 hypothetical protein GLYMA_08G175100 [Glycine max] 54 7e-06 KHN26782.1 Putative glutathione S-transferase [Glycine soja] 54 1e-05 >KRH43847.1 hypothetical protein GLYMA_08G175100 [Glycine max] Length = 207 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 426 IAWAKRCTQRESVSKTFPEEHRIKRYAEEK 337 IAWAKRCTQ+ESVSK FPEEHR+K + +K Sbjct: 171 IAWAKRCTQKESVSKCFPEEHRVKEFISKK 200 >KHN26782.1 Putative glutathione S-transferase [Glycine soja] Length = 331 Score = 53.9 bits (128), Expect = 1e-05 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -1 Query: 426 IAWAKRCTQRESVSKTFPEEHRIKRYAEEKGLGSLMKL 313 IAWAKRCTQ+ESVSK FPEEHR+K + +K M+L Sbjct: 154 IAWAKRCTQKESVSKCFPEEHRVKEFISKKKKNLNMQL 191