BLASTX nr result
ID: Glycyrrhiza35_contig00003753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00003753 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN04831.1 Polygalacturonase inhibitor 1 [Glycine soja] 66 8e-11 GAU23453.1 hypothetical protein TSUD_331510 [Trifolium subterran... 65 2e-10 NP_001239837.1 polygalacturonase inhibitor 1-like precursor [Gly... 65 2e-10 GAU23452.1 hypothetical protein TSUD_331500 [Trifolium subterran... 65 2e-10 KYP39406.1 Polygalacturonase inhibitor [Cajanus cajan] 64 3e-10 AFK46159.1 unknown [Medicago truncatula] 64 3e-10 XP_003625218.1 polygalacturonase inhibitor [Medicago truncatula]... 64 3e-10 GAU23455.1 hypothetical protein TSUD_331530 [Trifolium subterran... 64 6e-10 AAZ32892.1 polygalacturonase inhibitor protein, partial [Medicag... 61 1e-09 JAU17853.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 60 1e-09 KOM40318.1 hypothetical protein LR48_Vigan04g051600 [Vigna angul... 62 3e-09 XP_017421254.1 PREDICTED: polygalacturonase inhibitor-like [Vign... 62 3e-09 XP_012575553.1 PREDICTED: polygalacturonase inhibitor-like [Cice... 61 3e-09 AEZ54447.1 polygalacturonase-inhibiting protein 1, partial [Medi... 61 3e-09 XP_013467253.1 polygalacturonase inhibitor protein [Medicago tru... 60 7e-09 XP_010491273.1 PREDICTED: polygalacturonase inhibitor 2 [Camelin... 60 7e-09 XP_006290158.1 hypothetical protein CARUB_v10003826mg [Capsella ... 60 7e-09 XP_010521789.1 PREDICTED: DNA-damage-repair/toleration protein D... 60 8e-09 JAU48023.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 60 9e-09 JAU86092.1 Polygalacturonase inhibitor 2, partial [Noccaea caeru... 60 1e-08 >KHN04831.1 Polygalacturonase inhibitor 1 [Glycine soja] Length = 336 Score = 65.9 bits (159), Expect = 8e-11 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP F AQ K+LD++ LS N+LSGP+PSSL KLP+L L++S N+LTG Sbjct: 131 GPIPDFFAQLKNLDDIDLSFNNLSGPIPSSLGKLPKLAYLDLSRNKLTG 179 >GAU23453.1 hypothetical protein TSUD_331510 [Trifolium subterraneum] Length = 338 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLA+ K+L NL+LS N+LSGP+PS L +LP+L+ L + N+LTG Sbjct: 136 GPIPPFLAELKNLQNLHLSTNNLSGPIPSVLSQLPKLESLHLDRNKLTG 184 >NP_001239837.1 polygalacturonase inhibitor 1-like precursor [Glycine max] ACJ37404.1 leucine-rich repeat protein [Glycine max] KRH12977.1 hypothetical protein GLYMA_15G209300 [Glycine max] Length = 339 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP F AQ K+LD++ +S N+LSGP+PSSL KLP+L L++S N+LTG Sbjct: 134 GPIPDFFAQLKNLDDIDISFNNLSGPIPSSLGKLPKLAYLDLSRNKLTG 182 >GAU23452.1 hypothetical protein TSUD_331500 [Trifolium subterraneum] Length = 345 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLA+ K+L+ L+LS N+LSGP+PSSL +LP+L+ L + N+LTG Sbjct: 138 GPIPSFLAELKNLELLHLSTNNLSGPIPSSLSQLPKLESLHLDRNKLTG 186 >KYP39406.1 Polygalacturonase inhibitor [Cajanus cajan] Length = 335 Score = 64.3 bits (155), Expect = 3e-10 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GP+P FLAQ K+LD L LS N+LSGP+PSSL LP+L L+ S N+LTG Sbjct: 139 GPVPSFLAQLKNLDTLDLSFNNLSGPIPSSLTTLPKLTFLDFSRNKLTG 187 >AFK46159.1 unknown [Medicago truncatula] Length = 342 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ L + N+LTG Sbjct: 140 GPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLESLHLDRNKLTG 188 >XP_003625218.1 polygalacturonase inhibitor [Medicago truncatula] ABN08652.1 Leucine-rich repeat, plant specific [Medicago truncatula] AES81436.1 polygalacturonase inhibitor [Medicago truncatula] Length = 342 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ L + N+LTG Sbjct: 140 GPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLESLHLDRNKLTG 188 >GAU23455.1 hypothetical protein TSUD_331530 [Trifolium subterraneum] Length = 343 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ + + N+LTG Sbjct: 141 GPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLESIHLDRNKLTG 189 >AAZ32892.1 polygalacturonase inhibitor protein, partial [Medicago sativa] Length = 176 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLAQ K+L L+LS N+LSG +PSSL +LP L+ L + N+LTG Sbjct: 76 GPIPPFLAQLKNLQLLHLSTNNLSGSIPSSLSQLPNLESLHLDRNKLTG 124 >JAU17853.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 119 Score = 59.7 bits (143), Expect = 1e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FL+Q K+LD + LS N LSG +P+SL LP+L+ LE+S N+LTG Sbjct: 9 GPIPAFLSQLKNLDYINLSFNDLSGSIPASLSLLPKLEFLELSRNKLTG 57 >KOM40318.1 hypothetical protein LR48_Vigan04g051600 [Vigna angularis] Length = 336 Score = 61.6 bits (148), Expect = 3e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP+FLAQ K+L + LS N LSGP+PSSL +LP L L++ N+LTG Sbjct: 136 GPIPEFLAQIKTLQYIELSSNRLSGPIPSSLSQLPNLISLQLDRNKLTG 184 >XP_017421254.1 PREDICTED: polygalacturonase inhibitor-like [Vigna angularis] Length = 356 Score = 61.6 bits (148), Expect = 3e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP+FLAQ K+L + LS N LSGP+PSSL +LP L L++ N+LTG Sbjct: 156 GPIPEFLAQIKTLQYIELSSNRLSGPIPSSLSQLPNLISLQLDRNKLTG 204 >XP_012575553.1 PREDICTED: polygalacturonase inhibitor-like [Cicer arietinum] Length = 239 Score = 60.8 bits (146), Expect = 3e-09 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIPKF AQF++L NL LS N+L G LP SLY+LP LQ + ++N+LTG Sbjct: 43 GPIPKFTAQFENLVNLDLSHNNLFGTLPPSLYQLPSLQGVLFNNNKLTG 91 >AEZ54447.1 polygalacturonase-inhibiting protein 1, partial [Medicago sativa subsp. x varia] Length = 285 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FLAQ K+L L+LS N+LSG +PSSL +LP L+ L + N+LTG Sbjct: 94 GPIPPFLAQLKNLQLLHLSTNNLSGSIPSSLSQLPNLESLHLDRNKLTG 142 >XP_013467253.1 polygalacturonase inhibitor protein [Medicago truncatula] KEH41287.1 polygalacturonase inhibitor protein [Medicago truncatula] Length = 324 Score = 60.5 bits (145), Expect = 7e-09 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP F+A+ KSL L LS NHLSG LP +LYKLP L+ + + +N LTG Sbjct: 131 GPIPNFIAKLKSLTYLDLSENHLSGTLPHNLYKLPNLEAIILQNNILTG 179 >XP_010491273.1 PREDICTED: polygalacturonase inhibitor 2 [Camelina sativa] Length = 332 Score = 60.5 bits (145), Expect = 7e-09 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GP+P+FL Q K+L+ + LS N LSG +PSSL LP+L+ LE+S N+LTG Sbjct: 135 GPVPEFLTQLKNLEYIDLSFNDLSGSIPSSLSSLPKLEYLELSRNKLTG 183 >XP_006290158.1 hypothetical protein CARUB_v10003826mg [Capsella rubella] EOA23056.1 hypothetical protein CARUB_v10003826mg [Capsella rubella] Length = 332 Score = 60.5 bits (145), Expect = 7e-09 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP+FL+Q K+L+ + LS N LSG +PSSL LP+L+ LE+S N+LTG Sbjct: 135 GPIPEFLSQLKNLEYIDLSFNDLSGYIPSSLSSLPKLEYLELSRNKLTG 183 >XP_010521789.1 PREDICTED: DNA-damage-repair/toleration protein DRT100 [Tarenaya hassleriana] Length = 588 Score = 60.5 bits (145), Expect = 8e-09 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG*SND 96 GPIP F+ QF++L L LS N LSGPLP S+Y L +LQ L + HN L+G +D Sbjct: 217 GPIPDFIGQFRNLTYLDLSSNKLSGPLPVSIYALGKLQDLSLGHNELSGSLSD 269 >JAU48023.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 247 Score = 59.7 bits (143), Expect = 9e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FL+Q K+LD + LS N LSG +P+SL LP+L+ LE+S N+LTG Sbjct: 137 GPIPAFLSQLKNLDYINLSFNDLSGSIPASLSLLPKLEFLELSRNKLTG 185 >JAU86092.1 Polygalacturonase inhibitor 2, partial [Noccaea caerulescens] Length = 258 Score = 59.7 bits (143), Expect = 1e-08 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -3 Query: 254 GPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQQLEVSHNRLTG 108 GPIP FL+Q K+LD + LS N LSG +P+SL LP+L+ LE+S N+LTG Sbjct: 148 GPIPAFLSQLKNLDYINLSFNDLSGSIPASLSLLPKLEFLELSRNKLTG 196