BLASTX nr result
ID: Glycyrrhiza35_contig00003250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00003250 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SDK32730.1 ETC complex I subunit conserved region [Bradyrhizobiu... 54 1e-06 >SDK32730.1 ETC complex I subunit conserved region [Bradyrhizobium ottawaense] SEE39405.1 ETC complex I subunit conserved region [Bradyrhizobium lablabi] SHM36579.1 ETC complex I subunit conserved region [Bradyrhizobium lablabi] Length = 151 Score = 53.9 bits (128), Expect = 1e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = +2 Query: 206 YLRGRGITDQIVERCLYTIPADSFKLLPCPI----SYGARPSMTARIFKP 343 Y+RG GITDQ+ ERCLYTIP S K +G PSMTARIFKP Sbjct: 9 YIRGYGITDQVPERCLYTIPDVSAKRFHVAYLVTHLFGVLPSMTARIFKP 58