BLASTX nr result
ID: Glycyrrhiza35_contig00003097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00003097 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004152148.1 PREDICTED: inositol polyphosphate multikinase alp... 56 8e-07 XP_008454112.1 PREDICTED: inositol polyphosphate multikinase bet... 55 1e-06 XP_003627882.1 inositol polyphosphate multikinase beta-like prot... 55 1e-06 XP_004510840.1 PREDICTED: inositol polyphosphate multikinase bet... 54 3e-06 XP_019449563.1 PREDICTED: inositol polyphosphate multikinase bet... 54 4e-06 XP_015888363.1 PREDICTED: inositol polyphosphate multikinase bet... 53 9e-06 >XP_004152148.1 PREDICTED: inositol polyphosphate multikinase alpha [Cucumis sativus] XP_011653019.1 PREDICTED: inositol polyphosphate multikinase alpha [Cucumis sativus] KGN52989.1 hypothetical protein Csa_4G009900 [Cucumis sativus] Length = 305 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 245 HPHLVLEDL+S Y NP+I+DI+IGS+T P AS +DYI Sbjct: 81 HPHLVLEDLISNYENPTIVDIKIGSRTWYPQAS-EDYI 117 >XP_008454112.1 PREDICTED: inositol polyphosphate multikinase beta-like [Cucumis melo] XP_008454113.1 PREDICTED: inositol polyphosphate multikinase beta-like [Cucumis melo] Length = 305 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 245 HPHLVLEDL+S Y NPSI+DI+IGS+T P AS ++YI Sbjct: 81 HPHLVLEDLISNYENPSIVDIKIGSRTWYPQAS-EEYI 117 >XP_003627882.1 inositol polyphosphate multikinase beta-like protein [Medicago truncatula] AET02358.1 inositol polyphosphate multikinase beta-like protein [Medicago truncatula] Length = 426 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 245 HPHLVLED+VS Y NP+++DI+IGS+T +P S++DYI Sbjct: 223 HPHLVLEDIVSNYTNPAVVDIKIGSRTWHPQ-SSEDYI 259 >XP_004510840.1 PREDICTED: inositol polyphosphate multikinase beta [Cicer arietinum] Length = 296 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 245 HPHLV+ED+VS + NPS++DI+IGS+T +P S++DYI Sbjct: 83 HPHLVMEDIVSNFTNPSVVDIKIGSRTWHPQ-SSEDYI 119 >XP_019449563.1 PREDICTED: inositol polyphosphate multikinase beta-like [Lupinus angustifolius] OIW07959.1 hypothetical protein TanjilG_20060 [Lupinus angustifolius] Length = 306 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYIS 248 HPHLVLED+VS Y+NPS+ID++IGS+T P S+D Y+S Sbjct: 82 HPHLVLEDVVSCYSNPSVIDVKIGSRTWYPE-SSDAYVS 119 >XP_015888363.1 PREDICTED: inositol polyphosphate multikinase beta-like [Ziziphus jujuba] XP_015888364.1 PREDICTED: inositol polyphosphate multikinase beta-like [Ziziphus jujuba] Length = 293 Score = 52.8 bits (125), Expect = 9e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 132 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYIS 248 HPHLVLED+VS Y NPSI DI+IGS+T AS +DYIS Sbjct: 81 HPHLVLEDIVSSYPNPSIADIKIGSRTWYLEAS-EDYIS 118