BLASTX nr result
ID: Glycyrrhiza35_contig00002199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00002199 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGD55000.1 hypothetical protein DP49_5733 [Burkholderia pseudoma... 65 1e-12 CBX22841.1 unnamed protein product [Neisseria lactamica Y92-1009] 60 1e-10 XP_018009702.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 57 9e-09 CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] 55 2e-08 BAO82212.1 hypothetical protein SRAA_2358 [Comamonadaceae bacter... 52 2e-07 WP_003714551.1 hypothetical protein [Neisseria lactamica] CBX230... 53 2e-07 EFX63797.1 hypothetical protein DAPPUDRAFT_118838 [Daphnia pulex] 49 7e-06 >KGD55000.1 hypothetical protein DP49_5733 [Burkholderia pseudomallei] Length = 36 Score = 64.7 bits (156), Expect = 1e-12 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 136 LHSSVFGVCYGVVIRNGPHNHDSALPPKVIHEALPK 29 +HSSVFGVCYG VI N P NHDSALPPKV HEALPK Sbjct: 1 MHSSVFGVCYGGVICNRPPNHDSALPPKVRHEALPK 36 >CBX22841.1 unnamed protein product [Neisseria lactamica Y92-1009] Length = 49 Score = 60.1 bits (144), Expect = 1e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 84 GPLRITTP*QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRS 209 G L++T P QT NT + GRQT+GANVRCQEGNNPDR+LRS Sbjct: 4 GLLQLTNPWQTQNTIKWFLGRQTAGANVRCQEGNNPDRRLRS 45 >XP_018009702.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC108664000 [Hyalella azteca] Length = 120 Score = 57.0 bits (136), Expect = 9e-09 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 84 GPLRITTP*QTPNTEECNHGRQTSGANVRCQEGNNPDRQLR 206 G R+T P QTPNT+E + G + GANVR QEGNNPDRQLR Sbjct: 4 GSWRLTKPLQTPNTDEYSLGDRAPGANVRTQEGNNPDRQLR 44 >CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] Length = 59 Score = 54.7 bits (130), Expect = 2e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 111 QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRS 209 QTPNT EC+ G GANVR QEGNNPDRQLRS Sbjct: 2 QTPNTGECSAGDSAPGANVRTQEGNNPDRQLRS 34 >BAO82212.1 hypothetical protein SRAA_2358 [Comamonadaceae bacterium A1] BAO82213.1 hypothetical protein SRAA_2359 [Comamonadaceae bacterium A1] BAO84599.1 hypothetical protein SMCB_2371 [Comamonadaceae bacterium B1] BAO84600.1 hypothetical protein SMCB_2372 [Comamonadaceae bacterium B1] Length = 59 Score = 52.0 bits (123), Expect = 2e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 111 QTPNTEECNHGRQTSGANVRCQEGNNPDRQLRS 209 QTPNT+E + G + GANVR QEGNNPDRQLRS Sbjct: 2 QTPNTDEYSLGDRAPGANVRTQEGNNPDRQLRS 34 >WP_003714551.1 hypothetical protein [Neisseria lactamica] CBX23067.1 unnamed protein product [Neisseria lactamica Y92-1009] Length = 94 Score = 52.8 bits (125), Expect = 2e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 84 GPLRITTP*QTPNTEECNHGRQTSGANVRCQEGNNPDRQLR 206 G L++T P QT NT + GRQT+G NVRCQEGN PDR LR Sbjct: 4 GLLQLTNPWQTQNTIKWFLGRQTAGVNVRCQEGNYPDRWLR 44 >EFX63797.1 hypothetical protein DAPPUDRAFT_118838 [Daphnia pulex] Length = 109 Score = 49.3 bits (116), Expect = 7e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 111 QTPNTEECNHGRQTSGANVRCQEGNNPDRQLR 206 QTPNT E + G + GANVR QEGNNPDRQLR Sbjct: 2 QTPNTAEYSLGDRAPGANVRTQEGNNPDRQLR 33