BLASTX nr result
ID: Glycyrrhiza35_contig00000933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00000933 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507747.1 PREDICTED: uncharacterized protein LOC101490849 [... 67 5e-12 XP_011018043.1 PREDICTED: uncharacterized protein LOC105121190 i... 66 1e-11 XP_011018042.1 PREDICTED: uncharacterized protein LOC105121190 i... 66 2e-11 XP_008795203.1 PREDICTED: nucleoid-associated protein At2g24020,... 64 2e-11 XP_018828370.1 PREDICTED: nucleoid-associated protein At4g30620,... 65 3e-11 GAU18307.1 hypothetical protein TSUD_201950, partial [Trifolium ... 64 4e-11 OMO61715.1 YbaB-like DNA-binding protein [Corchorus capsularis] 65 4e-11 XP_016200292.1 PREDICTED: nucleoid-associated protein At4g30620,... 65 4e-11 XP_015892106.1 PREDICTED: nucleoid-associated protein At4g30620,... 65 4e-11 KYP54405.1 UPF0133 protein Synpcc7942-0464, partial [Cajanus cajan] 63 4e-11 XP_011079400.1 PREDICTED: uncharacterized protein LOC105162925 [... 64 5e-11 AFK40761.1 unknown [Lotus japonicus] 64 5e-11 KRH26163.1 hypothetical protein GLYMA_12G156200 [Glycine max] 64 5e-11 XP_002324535.2 hypothetical protein POPTR_0018s11460g [Populus t... 65 6e-11 XP_015933002.1 PREDICTED: nucleoid-associated protein At4g30620,... 64 8e-11 GAV83207.1 YbaB_DNA_bd domain-containing protein [Cephalotus fol... 64 8e-11 XP_007011904.2 PREDICTED: nucleoid-associated protein At2g24020,... 64 8e-11 XP_012444534.1 PREDICTED: uncharacterized protein LOC105768857 [... 64 8e-11 XP_016750348.1 PREDICTED: nucleoid-associated protein At2g24020,... 64 8e-11 EOY29523.1 Uncharacterized protein TCM_037033 isoform 2 [Theobro... 64 8e-11 >XP_004507747.1 PREDICTED: uncharacterized protein LOC101490849 [Cicer arietinum] Length = 189 Score = 67.0 bits (162), Expect = 5e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK Sbjct: 158 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 189 >XP_011018043.1 PREDICTED: uncharacterized protein LOC105121190 isoform X2 [Populus euphratica] Length = 196 Score = 65.9 bits (159), Expect = 1e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERM+DLAQSLGMPPGLGEGLK Sbjct: 165 DAHQKSVQAMKERMNDLAQSLGMPPGLGEGLK 196 >XP_011018042.1 PREDICTED: uncharacterized protein LOC105121190 isoform X1 [Populus euphratica] Length = 210 Score = 65.9 bits (159), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERM+DLAQSLGMPPGLGEGLK Sbjct: 179 DAHQKSVQAMKERMNDLAQSLGMPPGLGEGLK 210 >XP_008795203.1 PREDICTED: nucleoid-associated protein At2g24020, chloroplastic-like [Phoenix dactylifera] Length = 108 Score = 63.5 bits (153), Expect = 2e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQA+KERMS+LAQSLGMPPGLGEGLK Sbjct: 77 DAHQKSVQAVKERMSNLAQSLGMPPGLGEGLK 108 >XP_018828370.1 PREDICTED: nucleoid-associated protein At4g30620, chloroplastic-like [Juglans regia] Length = 193 Score = 65.1 bits (157), Expect = 3e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPG GEGLK Sbjct: 162 DAHQKSVQAMKERMSDLAQSLGMPPGAGEGLK 193 >GAU18307.1 hypothetical protein TSUD_201950, partial [Trifolium subterraneum] Length = 153 Score = 63.9 bits (154), Expect = 4e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGL 95 DAHQKSVQAMKERMSDLAQSLGMPPGLG+GL Sbjct: 123 DAHQKSVQAMKERMSDLAQSLGMPPGLGDGL 153 >OMO61715.1 YbaB-like DNA-binding protein [Corchorus capsularis] Length = 196 Score = 64.7 bits (156), Expect = 4e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPGL EGLK Sbjct: 163 DAHQKSVQAMKERMSDLAQSLGMPPGLSEGLK 194 >XP_016200292.1 PREDICTED: nucleoid-associated protein At4g30620, chloroplastic-like [Arachis ipaensis] Length = 196 Score = 64.7 bits (156), Expect = 4e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPGL EGLK Sbjct: 165 DAHQKSVQAMKERMSDLAQSLGMPPGLNEGLK 196 >XP_015892106.1 PREDICTED: nucleoid-associated protein At4g30620, chloroplastic [Ziziphus jujuba] Length = 197 Score = 64.7 bits (156), Expect = 4e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPG+G+GLK Sbjct: 166 DAHQKSVQAMKERMSDLAQSLGMPPGVGDGLK 197 >KYP54405.1 UPF0133 protein Synpcc7942-0464, partial [Cajanus cajan] Length = 114 Score = 62.8 bits (151), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMS+LAQSLGMPPGL EGLK Sbjct: 83 DAHQKSVQAMKERMSNLAQSLGMPPGLSEGLK 114 >XP_011079400.1 PREDICTED: uncharacterized protein LOC105162925 [Sesamum indicum] Length = 185 Score = 64.3 bits (155), Expect = 5e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSV AMKERMSDLAQSLGMPPGLGEGLK Sbjct: 153 DAHQKSVLAMKERMSDLAQSLGMPPGLGEGLK 184 >AFK40761.1 unknown [Lotus japonicus] Length = 191 Score = 64.3 bits (155), Expect = 5e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMS LAQSLGMPPGLGEGLK Sbjct: 160 DAHQKSVQAMKERMSGLAQSLGMPPGLGEGLK 191 >KRH26163.1 hypothetical protein GLYMA_12G156200 [Glycine max] Length = 155 Score = 63.5 bits (153), Expect = 5e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERM+DLAQSLGMPPGL EGLK Sbjct: 124 DAHQKSVQAMKERMNDLAQSLGMPPGLSEGLK 155 >XP_002324535.2 hypothetical protein POPTR_0018s11460g [Populus trichocarpa] EEF03100.2 hypothetical protein POPTR_0018s11460g [Populus trichocarpa] Length = 224 Score = 64.7 bits (156), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERM+DLAQSLGMPPG+GEGLK Sbjct: 193 DAHQKSVQAMKERMNDLAQSLGMPPGVGEGLK 224 >XP_015933002.1 PREDICTED: nucleoid-associated protein At4g30620, chloroplastic-like [Arachis duranensis] Length = 196 Score = 63.9 bits (154), Expect = 8e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMPPGL EG+K Sbjct: 165 DAHQKSVQAMKERMSDLAQSLGMPPGLNEGMK 196 >GAV83207.1 YbaB_DNA_bd domain-containing protein [Cephalotus follicularis] Length = 197 Score = 63.9 bits (154), Expect = 8e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMP GLGEGLK Sbjct: 166 DAHQKSVQAMKERMSDLAQSLGMPQGLGEGLK 197 >XP_007011904.2 PREDICTED: nucleoid-associated protein At2g24020, chloroplastic [Theobroma cacao] Length = 197 Score = 63.9 bits (154), Expect = 8e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMP GLGEGLK Sbjct: 165 DAHQKSVQAMKERMSDLAQSLGMPQGLGEGLK 196 >XP_012444534.1 PREDICTED: uncharacterized protein LOC105768857 [Gossypium raimondii] XP_016689529.1 PREDICTED: nucleoid-associated protein At2g24020, chloroplastic-like [Gossypium hirsutum] KJB54968.1 hypothetical protein B456_009G056300 [Gossypium raimondii] Length = 197 Score = 63.9 bits (154), Expect = 8e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMP GLGEGLK Sbjct: 164 DAHQKSVQAMKERMSDLAQSLGMPQGLGEGLK 195 >XP_016750348.1 PREDICTED: nucleoid-associated protein At2g24020, chloroplastic-like [Gossypium hirsutum] XP_017627351.1 PREDICTED: nucleoid-associated protein At2g24020, chloroplastic-like [Gossypium arboreum] KHG13116.1 hypothetical protein F383_20560 [Gossypium arboreum] Length = 197 Score = 63.9 bits (154), Expect = 8e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMP GLGEGLK Sbjct: 164 DAHQKSVQAMKERMSDLAQSLGMPQGLGEGLK 195 >EOY29523.1 Uncharacterized protein TCM_037033 isoform 2 [Theobroma cacao] Length = 197 Score = 63.9 bits (154), Expect = 8e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DAHQKSVQAMKERMSDLAQSLGMPPGLGEGLK 98 DAHQKSVQAMKERMSDLAQSLGMP GLGEGLK Sbjct: 165 DAHQKSVQAMKERMSDLAQSLGMPQGLGEGLK 196