BLASTX nr result
ID: Glycyrrhiza34_contig00030093
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00030093 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360... 93 9e-20 XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago ... 91 6e-19 XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 6e-19 XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-18 XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-18 XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus... 89 1e-18 XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 2e-18 XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 3e-18 CBI19832.3 unnamed protein product, partial [Vitis vinifera] 88 5e-18 XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing pr... 88 5e-18 XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 5e-18 XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 9e-18 KVF06906.1 Pentatricopeptide repeat-containing protein, partial ... 86 2e-17 XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis... 86 3e-17 KRG92255.1 hypothetical protein GLYMA_20G200100 [Glycine max] 85 4e-17 XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 4e-17 XP_010271478.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 6e-17 KDP46745.1 hypothetical protein JCGZ_06533 [Jatropha curcas] 80 6e-17 XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing pr... 84 8e-17 >KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360 family [Cajanus cajan] Length = 722 Score = 92.8 bits (229), Expect = 9e-20 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKFISK+VEREIVVRDRKRFHHFRNGECSCGNYW Sbjct: 683 GDCHNAFKFISKVVEREIVVRDRKRFHHFRNGECSCGNYW 722 >XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES60995.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 795 Score = 90.5 bits (223), Expect = 6e-19 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFK+ISK+VEREIVVRDRKRFHHF+NGECSCGNYW Sbjct: 756 GDCHNAFKYISKVVEREIVVRDRKRFHHFKNGECSCGNYW 795 >XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] XP_012569722.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] Length = 795 Score = 90.5 bits (223), Expect = 6e-19 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKFISK+V REIVVRDRKRFHHFRNGECSCGNYW Sbjct: 756 GDCHNAFKFISKVVAREIVVRDRKRFHHFRNGECSCGNYW 795 >XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna radiata var. radiata] Length = 787 Score = 89.4 bits (220), Expect = 1e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 748 GDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna angularis] KOM52437.1 hypothetical protein LR48_Vigan09g109600 [Vigna angularis] BAT94687.1 hypothetical protein VIGAN_08130900 [Vigna angularis var. angularis] Length = 787 Score = 89.4 bits (220), Expect = 1e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 748 GDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] ESW16129.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] Length = 787 Score = 89.4 bits (220), Expect = 1e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCH+AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 748 GDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis ipaensis] Length = 789 Score = 89.0 bits (219), Expect = 2e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKFIS++V+REIVVRDRKRFHHF+NGECSCGNYW Sbjct: 750 GDCHNAFKFISRVVKREIVVRDRKRFHHFKNGECSCGNYW 789 >XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Lupinus angustifolius] Length = 787 Score = 88.6 bits (218), Expect = 3e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKFIS++V REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 748 GDCHNAFKFISRVVGREIIVRDRKRFHHFRNGECSCGNYW 787 >CBI19832.3 unnamed protein product, partial [Vitis vinifera] Length = 544 Score = 87.8 bits (216), Expect = 5e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 505 GDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Glycine max] KRH34548.1 hypothetical protein GLYMA_10G190600 [Glycine max] Length = 787 Score = 87.8 bits (216), Expect = 5e-18 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFK+ISK+V+REI+VRDRKRFHHFRNGECSC NYW Sbjct: 748 GDCHNAFKYISKVVDREIIVRDRKRFHHFRNGECSCSNYW 787 >XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 87.8 bits (216), Expect = 5e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 760 GDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis duranensis] Length = 789 Score = 87.0 bits (214), Expect = 9e-18 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKFIS++V+REIVVRDRKRFHHF+NGECSCG+YW Sbjct: 750 GDCHNAFKFISRVVKREIVVRDRKRFHHFKNGECSCGDYW 789 >KVF06906.1 Pentatricopeptide repeat-containing protein, partial [Cynara cardunculus var. scolymus] Length = 817 Score = 85.9 bits (211), Expect = 2e-17 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKF+S++VEREIVVRD KRFHHFRNG+CSCGNYW Sbjct: 778 GDCHNAFKFMSQVVEREIVVRDGKRFHHFRNGKCSCGNYW 817 >XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Ziziphus jujuba] Length = 800 Score = 85.5 bits (210), Expect = 3e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFKF+SK+VEREI+VRD KRFHHFR GECSCGNYW Sbjct: 761 GDCHNAFKFMSKVVEREIIVRDGKRFHHFRYGECSCGNYW 800 >XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis] EXB53614.1 hypothetical protein L484_005164 [Morus notabilis] Length = 800 Score = 85.5 bits (210), Expect = 3e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAF F+S++VEREIVVRD KRFHHFRNGECSCGNYW Sbjct: 761 GDCHNAFMFMSRVVEREIVVRDGKRFHHFRNGECSCGNYW 800 >KRG92255.1 hypothetical protein GLYMA_20G200100 [Glycine max] Length = 686 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 4 DCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 DCHNAFK+ISKLV++EI+VRDRKRFHHFRNGECSC NYW Sbjct: 648 DCHNAFKYISKLVDQEIIVRDRKRFHHFRNGECSCSNYW 686 >XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Juglans regia] Length = 797 Score = 85.1 bits (209), Expect = 4e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFK++SK+V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 758 GDCHNAFKYMSKVVGREIVVRDGKRFHHFRNGECSCGNYW 797 >XP_010271478.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nelumbo nucifera] Length = 801 Score = 84.7 bits (208), Expect = 6e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCH AFKF+SK+VEREIVVRD KRFHHFR+GECSCGNYW Sbjct: 762 GDCHTAFKFMSKVVEREIVVRDGKRFHHFRDGECSCGNYW 801 >KDP46745.1 hypothetical protein JCGZ_06533 [Jatropha curcas] Length = 161 Score = 80.5 bits (197), Expect = 6e-17 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFK++SK+V REIVVRD KRFHHFR+G+CSCG+YW Sbjct: 122 GDCHNAFKYMSKVVSREIVVRDGKRFHHFRDGKCSCGDYW 161 >XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Fragaria vesca subsp. vesca] Length = 754 Score = 84.3 bits (207), Expect = 8e-17 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 1 GDCHNAFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 120 GDCHNAFK++S++V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 715 GDCHNAFKYMSRVVGREIVVRDAKRFHHFRNGECSCGNYW 754