BLASTX nr result
ID: Glycyrrhiza34_contig00030080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00030080 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019462522.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 7e-20 OIV99843.1 hypothetical protein TanjilG_26181 [Lupinus angustifo... 92 7e-20 XP_016173075.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-18 XP_015933096.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-18 XP_003610281.1 pentatricopeptide (PPR) repeat protein [Medicago ... 87 5e-18 XP_007154866.1 hypothetical protein PHAVU_003G154400g [Phaseolus... 84 4e-17 XP_004507756.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 7e-17 XP_014508629.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 9e-17 XP_017413108.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 1e-16 KHN14137.1 Pentatricopeptide repeat-containing protein [Glycine ... 81 4e-16 KYP51457.1 Pentatricopeptide repeat-containing protein At4g30700... 80 1e-15 KHN17508.1 Pentatricopeptide repeat-containing protein [Glycine ... 79 3e-15 XP_003550682.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 3e-15 XP_002275298.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 4e-11 XP_015892248.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 8e-11 EYU34329.1 hypothetical protein MIMGU_mgv1a001967mg [Erythranthe... 65 2e-10 XP_012841097.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 GAV77710.1 PPR domain-containing protein/PPR_2 domain-containing... 65 3e-10 XP_018505127.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 4e-10 XP_008362867.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 4e-10 >XP_019462522.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Lupinus angustifolius] Length = 793 Score = 92.0 bits (227), Expect = 7e-20 Identities = 43/70 (61%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNT+TWNTMIFGYGLHGYGHEALKLFNEMLHLGFH + Sbjct: 469 CGKVSEAWQLFDSMSEKNTITWNTMIFGYGLHGYGHEALKLFNEMLHLGFHPSSVTFLSV 528 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 529 LYACSHAGLV 538 >OIV99843.1 hypothetical protein TanjilG_26181 [Lupinus angustifolius] Length = 2080 Score = 92.0 bits (227), Expect = 7e-20 Identities = 43/70 (61%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNT+TWNTMIFGYGLHGYGHEALKLFNEMLHLGFH + Sbjct: 1108 CGKVSEAWQLFDSMSEKNTITWNTMIFGYGLHGYGHEALKLFNEMLHLGFHPSSVTFLSV 1167 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 1168 LYACSHAGLV 1177 >XP_016173075.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700, partial [Arachis ipaensis] Length = 765 Score = 87.0 bits (214), Expect = 4e-18 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHG+GHEALKLFNEMLHLGF + Sbjct: 441 CGNISEAWQLFDSMSEKNTVTWNTMIFGYGLHGHGHEALKLFNEMLHLGFQPSSVTFLSV 500 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 501 MYACSHAGLV 510 >XP_015933096.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Arachis duranensis] Length = 788 Score = 87.0 bits (214), Expect = 4e-18 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHG+GHEALKLFNEMLHLGF + Sbjct: 464 CGNISEAWQLFDSMSEKNTVTWNTMIFGYGLHGHGHEALKLFNEMLHLGFQPSSVTFLSV 523 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 524 MYACSHAGLV 533 >XP_003610281.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES92478.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 783 Score = 86.7 bits (213), Expect = 5e-18 Identities = 41/70 (58%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHGYGHEALKL+NEMLHLG++ + Sbjct: 459 CGNISEAWQLFDSMSEKNTVTWNTMIFGYGLHGYGHEALKLYNEMLHLGYNPSAVTFLSV 518 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 519 LYACSHAGLV 528 >XP_007154866.1 hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] ESW26860.1 hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] Length = 778 Score = 84.3 bits (207), Expect = 4e-17 Identities = 42/70 (60%), Positives = 46/70 (65%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHGYGHEAL+LFNEML LGF + Sbjct: 454 CGNILEAWQLFDSMSEKNTVTWNTMIFGYGLHGYGHEALQLFNEMLELGFQPSSVTFLSI 513 Query: 31 SHVCLQSSLV 2 + C S LV Sbjct: 514 LYACSHSGLV 523 >XP_004507756.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Cicer arietinum] Length = 783 Score = 83.6 bits (205), Expect = 7e-17 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 4/57 (7%) Frame = -3 Query: 160 MSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPFSHVCLQSSLV 2 M+EKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGF+ + + C + LV Sbjct: 472 MNEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFNPSAVTFLSVLYACSHAGLV 528 >XP_014508629.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vigna radiata var. radiata] Length = 778 Score = 83.2 bits (204), Expect = 9e-17 Identities = 41/70 (58%), Positives = 46/70 (65%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHGYGHEAL+LFNEML LGF + Sbjct: 454 CGNILEAWQLFESMSEKNTVTWNTMIFGYGLHGYGHEALQLFNEMLELGFQPSSVTFLSV 513 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 514 LYACSHAGLV 523 >XP_017413108.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vigna angularis] KOM32868.1 hypothetical protein LR48_Vigan01g242400 [Vigna angularis] BAT76160.1 hypothetical protein VIGAN_01412300 [Vigna angularis var. angularis] Length = 778 Score = 82.8 bits (203), Expect = 1e-16 Identities = 41/70 (58%), Positives = 46/70 (65%), Gaps = 4/70 (5%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPF 32 C + W SMSEKNTVTWNTMIFGYGLHGYGHEAL+LFNEML LGF + Sbjct: 454 CGNILEAWQLFDSMSEKNTVTWNTMIFGYGLHGYGHEALQLFNEMLELGFQPSSVTFLSV 513 Query: 31 SHVCLQSSLV 2 + C + LV Sbjct: 514 LYACSHAGLV 523 >KHN14137.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 428 Score = 81.3 bits (199), Expect = 4e-16 Identities = 37/50 (74%), Positives = 38/50 (76%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGF 50 C + W SEKNTVTWNT IFGYGLHGYGHEALKLFNEMLHLGF Sbjct: 147 CGNISEAWQLFDLTSEKNTVTWNTRIFGYGLHGYGHEALKLFNEMLHLGF 196 >KYP51457.1 Pentatricopeptide repeat-containing protein At4g30700 family [Cajanus cajan] Length = 643 Score = 79.7 bits (195), Expect = 1e-15 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -3 Query: 199 CSPQEKKWVCQASMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGF 50 C + W SMSEKNTVTWNTMIFGYGLHGYGH+AL+LFNEML L F Sbjct: 319 CGNISEAWQLFESMSEKNTVTWNTMIFGYGLHGYGHDALELFNEMLRLEF 368 >KHN17508.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 650 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/56 (67%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -3 Query: 157 SEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPFSHVCLQSSLV 2 SEKNTVTWNTMIFGYGLHGYG EALKLFNEMLHLGF + + C + LV Sbjct: 340 SEKNTVTWNTMIFGYGLHGYGDEALKLFNEMLHLGFQPSSVTFLSVLYACSHAGLV 395 >XP_003550682.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Glycine max] KRH03024.1 hypothetical protein GLYMA_17G072100 [Glycine max] Length = 778 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/56 (67%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -3 Query: 157 SEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLGFH----RYFPFSHVCLQSSLV 2 SEKNTVTWNTMIFGYGLHGYG EALKLFNEMLHLGF + + C + LV Sbjct: 468 SEKNTVTWNTMIFGYGLHGYGDEALKLFNEMLHLGFQPSSVTFLSVLYACSHAGLV 523 >XP_002275298.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vitis vinifera] Length = 781 Score = 67.0 bits (162), Expect = 4e-11 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -3 Query: 160 MSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLH 59 M EKN VTWN MI GYGLHGYGHEAL LFNEMLH Sbjct: 470 MPEKNAVTWNAMISGYGLHGYGHEALNLFNEMLH 503 >XP_015892248.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Ziziphus jujuba] XP_015892257.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Ziziphus jujuba] Length = 781 Score = 66.2 bits (160), Expect = 8e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLH 59 SM+EKN VTWN MI GYGLHG+GH+ALKLF+EMLH Sbjct: 469 SMTEKNAVTWNAMISGYGLHGHGHDALKLFSEMLH 503 >EYU34329.1 hypothetical protein MIMGU_mgv1a001967mg [Erythranthe guttata] Length = 732 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLG 53 S+ EKN VTWN+MI GYGLHGYGHEALKLF+EML G Sbjct: 419 SLQEKNVVTWNSMISGYGLHGYGHEALKLFDEMLLSG 455 >XP_012841097.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Erythranthe guttata] Length = 788 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLG 53 S+ EKN VTWN+MI GYGLHGYGHEALKLF+EML G Sbjct: 475 SLQEKNVVTWNSMISGYGLHGYGHEALKLFDEMLLSG 511 >GAV77710.1 PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein, partial [Cephalotus follicularis] Length = 792 Score = 64.7 bits (156), Expect = 3e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLG 53 S+ EKN VTWN+MI GYGLHG+GH+ALK+F+EMLH G Sbjct: 475 SVPEKNLVTWNSMISGYGLHGHGHDALKIFDEMLHSG 511 >XP_018505127.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Pyrus x bretschneideri] Length = 789 Score = 64.3 bits (155), Expect = 4e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLG 53 SM+EKN VTWN MI YGLHG GHEALKLF EMLH G Sbjct: 477 SMTEKNVVTWNAMISAYGLHGDGHEALKLFTEMLHSG 513 >XP_008362867.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Malus domestica] Length = 789 Score = 64.3 bits (155), Expect = 4e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 163 SMSEKNTVTWNTMIFGYGLHGYGHEALKLFNEMLHLG 53 SM+EKN VTWN MI YGLHG GHEALKLF EMLH G Sbjct: 477 SMTEKNVVTWNAMISAYGLHGDGHEALKLFTEMLHSG 513