BLASTX nr result
ID: Glycyrrhiza34_contig00030070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00030070 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75671.1 RanBP2-type zinc finger protein At1g67325 [Cajanus ca... 90 2e-20 BAT86626.1 hypothetical protein VIGAN_04429800 [Vigna angularis ... 84 4e-17 XP_013461218.1 Zn-finger, RanBP-type, containing protein [Medica... 67 3e-11 XP_019414710.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 3e-06 XP_019414709.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 3e-06 XP_019414708.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 3e-06 OIV98467.1 hypothetical protein TanjilG_16794 [Lupinus angustifo... 53 3e-06 >KYP75671.1 RanBP2-type zinc finger protein At1g67325 [Cajanus cajan] Length = 215 Score = 89.7 bits (221), Expect = 2e-20 Identities = 41/69 (59%), Positives = 52/69 (75%) Frame = +1 Query: 7 DQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWLIMWIRWTLWKSLT 186 DQ+D+VCCVK+ HF +L S L QL VF EQLC+I+ I KW+AVVK + +W LWKS + Sbjct: 135 DQSDQVCCVKYIHFVSLHSLLQQLWVFREQLCNIMYILKWEAVVK---LPFKWILWKSFS 191 Query: 187 FASCHLDPF 213 FAS HL+PF Sbjct: 192 FASFHLEPF 200 >BAT86626.1 hypothetical protein VIGAN_04429800 [Vigna angularis var. angularis] Length = 390 Score = 83.6 bits (205), Expect = 4e-17 Identities = 43/81 (53%), Positives = 55/81 (67%) Frame = +1 Query: 1 SPDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWLIMWIRWTLWKS 180 S DQND+VCC+K FHF NL LLQ +VF EQLCD++NIFK ++VVK + +W L KS Sbjct: 277 SADQNDQVCCLKCFHFVNLH-LLLQQLVFQEQLCDMMNIFKLQSVVK---LSFKWILRKS 332 Query: 181 LTFASCHLDPFVQLTDTHTHL 243 +FAS HL PF ++L Sbjct: 333 FSFASIHLKPFCYTFSVSSYL 353 >XP_013461218.1 Zn-finger, RanBP-type, containing protein [Medicago truncatula] KEH35253.1 Zn-finger, RanBP-type, containing protein [Medicago truncatula] Length = 332 Score = 67.0 bits (162), Expect = 3e-11 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 1 SPDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWL 147 SPDQN++VC VK F A L L Q +VFHEQLCDIVNIFK KAVV +L Sbjct: 278 SPDQNEQVCYVKPFQSAKLHLLLQQRLVFHEQLCDIVNIFKLKAVVMFL 326 >XP_019414710.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X3 [Lupinus angustifolius] Length = 323 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 4 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 138 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 279 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 323 >XP_019414709.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X2 [Lupinus angustifolius] Length = 324 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 4 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 138 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 280 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 324 >XP_019414708.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X1 [Lupinus angustifolius] Length = 325 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 4 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 138 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 281 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 325 >OIV98467.1 hypothetical protein TanjilG_16794 [Lupinus angustifolius] Length = 621 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 4 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 138 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 577 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 621