BLASTX nr result
ID: Glycyrrhiza34_contig00029234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029234 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013458587.1 cellulose synthase-like protein [Medicago truncat... 111 8e-27 AFR38848.1 cellulose synthase, partial [Populus alba] AFR38849.1... 99 5e-25 AFR38858.1 cellulose synthase, partial [Populus fremontii] AFR38... 99 5e-25 AFR38857.1 cellulose synthase, partial [Populus fremontii] 99 5e-25 AFR39112.1 cellulose synthase, partial [Populus trichocarpa] 97 5e-25 AFR38854.1 cellulose synthase, partial [Populus alba] 99 6e-25 AFR38855.1 cellulose synthase, partial [Populus fremontii] AFR38... 99 6e-25 AFR38875.1 cellulose synthase, partial [Populus nigra] AFR38877.... 99 6e-25 AFR38868.1 cellulose synthase, partial [Populus nigra] AFR38870.... 99 6e-25 AFR38850.1 cellulose synthase, partial [Populus alba] AFR38851.1... 99 6e-25 AFR38838.1 cellulose synthase, partial [Populus trichocarpa] AFR... 99 6e-25 AFR39100.1 cellulose synthase, partial [Populus trichocarpa] 97 6e-25 AFR39107.1 cellulose synthase, partial [Populus trichocarpa] 97 6e-25 AFR39108.1 cellulose synthase, partial [Populus trichocarpa] 97 7e-25 AFR39114.1 cellulose synthase, partial [Populus alba] 97 1e-24 AFR39120.1 cellulose synthase, partial [Populus fremontii] AFR39... 97 1e-24 AFR39117.1 cellulose synthase, partial [Populus alba] AFR39122.1... 97 2e-24 AFR39118.1 cellulose synthase, partial [Populus alba] 97 2e-24 AFR39127.1 cellulose synthase, partial [Populus fremontii] 97 2e-24 AFR39104.1 cellulose synthase, partial [Populus trichocarpa] 97 2e-24 >XP_013458587.1 cellulose synthase-like protein [Medicago truncatula] KEH32618.1 cellulose synthase-like protein [Medicago truncatula] Length = 1072 Score = 111 bits (277), Expect = 8e-27 Identities = 52/64 (81%), Positives = 58/64 (90%), Gaps = 2/64 (3%) Frame = +2 Query: 38 ISDSH--STNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKK 211 +S+ H ++N C+FQVRVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQTGKK Sbjct: 538 LSEPHLLDSSNNLCNFQVRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQTGKK 597 Query: 212 VCYV 223 VCYV Sbjct: 598 VCYV 601 >AFR38848.1 cellulose synthase, partial [Populus alba] AFR38849.1 cellulose synthase, partial [Populus alba] Length = 137 Score = 99.0 bits (245), Expect = 5e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 61 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 119 >AFR38858.1 cellulose synthase, partial [Populus fremontii] AFR38861.1 cellulose synthase, partial [Populus fremontii] Length = 138 Score = 99.0 bits (245), Expect = 5e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 62 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 120 >AFR38857.1 cellulose synthase, partial [Populus fremontii] Length = 138 Score = 99.0 bits (245), Expect = 5e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 60 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 118 >AFR39112.1 cellulose synthase, partial [Populus trichocarpa] Length = 88 Score = 97.4 bits (241), Expect = 5e-25 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 6 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 64 >AFR38854.1 cellulose synthase, partial [Populus alba] Length = 139 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 62 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 120 >AFR38855.1 cellulose synthase, partial [Populus fremontii] AFR38863.1 cellulose synthase, partial [Populus fremontii] AFR38864.1 cellulose synthase, partial [Populus fremontii] AFR38865.1 cellulose synthase, partial [Populus fremontii] AFR38866.1 cellulose synthase, partial [Populus fremontii] AFR38867.1 cellulose synthase, partial [Populus fremontii] Length = 140 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 62 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 120 >AFR38875.1 cellulose synthase, partial [Populus nigra] AFR38877.1 cellulose synthase, partial [Populus nigra] Length = 141 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 63 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 121 >AFR38868.1 cellulose synthase, partial [Populus nigra] AFR38870.1 cellulose synthase, partial [Populus nigra] AFR38874.1 cellulose synthase, partial [Populus nigra] AFR38876.1 cellulose synthase, partial [Populus nigra] Length = 141 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 63 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 121 >AFR38850.1 cellulose synthase, partial [Populus alba] AFR38851.1 cellulose synthase, partial [Populus alba] AFR38852.1 cellulose synthase, partial [Populus alba] AFR38853.1 cellulose synthase, partial [Populus alba] Length = 141 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 63 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 121 >AFR38838.1 cellulose synthase, partial [Populus trichocarpa] AFR38839.1 cellulose synthase, partial [Populus trichocarpa] AFR38840.1 cellulose synthase, partial [Populus trichocarpa] AFR38841.1 cellulose synthase, partial [Populus trichocarpa] AFR38842.1 cellulose synthase, partial [Populus trichocarpa] AFR38843.1 cellulose synthase, partial [Populus trichocarpa] AFR38844.1 cellulose synthase, partial [Populus trichocarpa] AFR38845.1 cellulose synthase, partial [Populus trichocarpa] AFR38846.1 cellulose synthase, partial [Populus trichocarpa] AFR38847.1 cellulose synthase, partial [Populus trichocarpa] AFR38859.1 cellulose synthase, partial [Populus fremontii] AFR38860.1 cellulose synthase, partial [Populus fremontii] AFR38862.1 cellulose synthase, partial [Populus fremontii] AFR38869.1 cellulose synthase, partial [Populus nigra] AFR38871.1 cellulose synthase, partial [Populus nigra] AFR38872.1 cellulose synthase, partial [Populus nigra] AFR38873.1 cellulose synthase, partial [Populus nigra] AFR38878.1 cellulose synthase, partial [Populus nigra] AFR38879.1 cellulose synthase, partial [Populus nigra] AFR38880.1 cellulose synthase, partial [Populus nigra] AFR38881.1 cellulose synthase, partial [Populus nigra] Length = 141 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/59 (79%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQ GKKVCYV Sbjct: 63 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQIGKKVCYV 121 >AFR39100.1 cellulose synthase, partial [Populus trichocarpa] Length = 91 Score = 97.4 bits (241), Expect = 6e-25 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 9 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 67 >AFR39107.1 cellulose synthase, partial [Populus trichocarpa] Length = 94 Score = 97.4 bits (241), Expect = 6e-25 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 12 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 70 >AFR39108.1 cellulose synthase, partial [Populus trichocarpa] Length = 82 Score = 97.1 bits (240), Expect = 7e-25 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +2 Query: 83 VRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 12 IRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 58 >AFR39114.1 cellulose synthase, partial [Populus alba] Length = 115 Score = 97.4 bits (241), Expect = 1e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 43 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 101 >AFR39120.1 cellulose synthase, partial [Populus fremontii] AFR39126.1 cellulose synthase, partial [Populus fremontii] Length = 124 Score = 97.4 bits (241), Expect = 1e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 42 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 100 >AFR39117.1 cellulose synthase, partial [Populus alba] AFR39122.1 cellulose synthase, partial [Populus fremontii] AFR39124.1 cellulose synthase, partial [Populus fremontii] Length = 125 Score = 97.4 bits (241), Expect = 2e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 43 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 101 >AFR39118.1 cellulose synthase, partial [Populus alba] Length = 126 Score = 97.4 bits (241), Expect = 2e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 44 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 102 >AFR39127.1 cellulose synthase, partial [Populus fremontii] Length = 127 Score = 97.4 bits (241), Expect = 2e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 45 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 103 >AFR39104.1 cellulose synthase, partial [Populus trichocarpa] Length = 127 Score = 97.4 bits (241), Expect = 2e-24 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 47 SHSTNNCCCDFQVRVSAVLTNAPFMLNLDCDHYVNNSKAVREAMCFLMDPQTGKKVCYV 223 SH + +RVSAVLTNAPFMLNLDCDHY+NNSKAVREAMCFLMDPQ GK+VCYV Sbjct: 45 SHHKKAGAMNALIRVSAVLTNAPFMLNLDCDHYINNSKAVREAMCFLMDPQIGKRVCYV 103