BLASTX nr result
ID: Glycyrrhiza34_contig00029172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029172 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN31005.1 Protein CHUP1, chloroplastic [Glycine soja] 81 1e-16 KHN47191.1 Protein CHUP1, chloroplastic [Glycine soja] 81 2e-16 XP_003528484.1 PREDICTED: protein CHUP1, chloroplastic [Glycine ... 81 7e-16 XP_019425980.1 PREDICTED: protein CHUP1, chloroplastic-like [Lup... 81 9e-16 XP_003542702.1 PREDICTED: protein CHUP1, chloroplastic-like [Gly... 81 9e-16 KYP43297.1 hypothetical protein KK1_035253 [Cajanus cajan] 80 2e-15 OIV91696.1 hypothetical protein TanjilG_26549 [Lupinus angustifo... 79 4e-15 XP_017434272.1 PREDICTED: protein CHUP1, chloroplastic-like [Vig... 79 6e-15 XP_016190013.1 PREDICTED: protein CHUP1, chloroplastic-like isof... 77 2e-14 XP_016190011.1 PREDICTED: protein CHUP1, chloroplastic-like isof... 77 2e-14 XP_014517737.1 PREDICTED: protein CHUP1, chloroplastic-like isof... 77 2e-14 XP_004505134.1 PREDICTED: protein CHUP1, chloroplastic [Cicer ar... 77 3e-14 XP_017411957.1 PREDICTED: protein CHUP1, chloroplastic-like [Vig... 76 4e-14 XP_014510685.1 PREDICTED: protein CHUP1, chloroplastic-like [Vig... 76 4e-14 KYP42171.1 hypothetical protein KK1_036425 [Cajanus cajan] 76 5e-14 KHN08450.1 Protein CHUP1, chloroplastic [Glycine soja] 75 7e-14 XP_007148061.1 hypothetical protein PHAVU_006G177200g [Phaseolus... 75 7e-14 XP_006594558.1 PREDICTED: protein CHUP1, chloroplastic-like [Gly... 75 7e-14 XP_007153708.1 hypothetical protein PHAVU_003G058200g [Phaseolus... 74 2e-13 GAU14574.1 hypothetical protein TSUD_96380 [Trifolium subterraneum] 74 2e-13 >KHN31005.1 Protein CHUP1, chloroplastic [Glycine soja] Length = 251 Score = 81.3 bits (199), Expect = 1e-16 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSAHY 120 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK CRSA Y Sbjct: 203 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFFCRSATY 242 >KHN47191.1 Protein CHUP1, chloroplastic [Glycine soja] Length = 242 Score = 80.9 bits (198), Expect = 2e-16 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKL CRSA Sbjct: 203 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLFCRSA 240 >XP_003528484.1 PREDICTED: protein CHUP1, chloroplastic [Glycine max] KRH50164.1 hypothetical protein GLYMA_07G205100 [Glycine max] Length = 617 Score = 81.3 bits (199), Expect = 7e-16 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSAHY 120 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK CRSA Y Sbjct: 569 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFFCRSATY 608 >XP_019425980.1 PREDICTED: protein CHUP1, chloroplastic-like [Lupinus angustifolius] Length = 556 Score = 80.9 bits (198), Expect = 9e-16 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK LCRSA Sbjct: 517 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFLCRSA 554 >XP_003542702.1 PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] KRH20332.1 hypothetical protein GLYMA_13G171100 [Glycine max] Length = 615 Score = 80.9 bits (198), Expect = 9e-16 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKL CRSA Sbjct: 576 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLFCRSA 613 >KYP43297.1 hypothetical protein KK1_035253 [Cajanus cajan] Length = 574 Score = 79.7 bits (195), Expect = 2e-15 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSCH+QCHSQQQK LCRSA Sbjct: 535 AGGFDVETMRAFQELRDKARSCHLQCHSQQQKFLCRSA 572 >OIV91696.1 hypothetical protein TanjilG_26549 [Lupinus angustifolius] Length = 571 Score = 79.0 bits (193), Expect = 4e-15 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK LCR A Sbjct: 517 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFLCRMA 554 >XP_017434272.1 PREDICTED: protein CHUP1, chloroplastic-like [Vigna angularis] KOM53697.1 hypothetical protein LR48_Vigan09g235600 [Vigna angularis] BAT87171.1 hypothetical protein VIGAN_05051400 [Vigna angularis var. angularis] Length = 603 Score = 78.6 bits (192), Expect = 6e-15 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSAHY 120 AGGFDVETMRAFQELRDKARSC +QCHSQQQK LCRSA Y Sbjct: 564 AGGFDVETMRAFQELRDKARSCQLQCHSQQQKFLCRSATY 603 >XP_016190013.1 PREDICTED: protein CHUP1, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016190014.1 PREDICTED: protein CHUP1, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 649 Score = 77.4 bits (189), Expect = 2e-14 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRS 111 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK CRS Sbjct: 610 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFYCRS 646 >XP_016190011.1 PREDICTED: protein CHUP1, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016190012.1 PREDICTED: protein CHUP1, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 653 Score = 77.4 bits (189), Expect = 2e-14 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRS 111 AGGFDVETMRAFQELRDKARSCHVQCHSQQQK CRS Sbjct: 614 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKFYCRS 650 >XP_014517737.1 PREDICTED: protein CHUP1, chloroplastic-like isoform X1 [Vigna radiata var. radiata] Length = 603 Score = 77.0 bits (188), Expect = 2e-14 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSAHY 120 AGGFDVETMRAFQELRDKARSC +QCHSQQQK CRSA Y Sbjct: 564 AGGFDVETMRAFQELRDKARSCQLQCHSQQQKFFCRSATY 603 >XP_004505134.1 PREDICTED: protein CHUP1, chloroplastic [Cicer arietinum] Length = 630 Score = 76.6 bits (187), Expect = 3e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFD +TMRAFQELRDKARSCHVQCH QQQK LCRSA Sbjct: 591 AGGFDADTMRAFQELRDKARSCHVQCHGQQQKFLCRSA 628 >XP_017411957.1 PREDICTED: protein CHUP1, chloroplastic-like [Vigna angularis] KOM31878.1 hypothetical protein LR48_Vigan01g143400 [Vigna angularis] BAT75008.1 hypothetical protein VIGAN_01280000 [Vigna angularis var. angularis] Length = 635 Score = 76.3 bits (186), Expect = 4e-14 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDV+TMRAFQELRDKARSCH+QCH QQQK CRSA Sbjct: 596 AGGFDVDTMRAFQELRDKARSCHIQCHGQQQKFFCRSA 633 >XP_014510685.1 PREDICTED: protein CHUP1, chloroplastic-like [Vigna radiata var. radiata] Length = 642 Score = 76.3 bits (186), Expect = 4e-14 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDV+TMRAFQELRDKARSCH+QCH QQQK CRSA Sbjct: 603 AGGFDVDTMRAFQELRDKARSCHIQCHGQQQKFFCRSA 640 >KYP42171.1 hypothetical protein KK1_036425 [Cajanus cajan] Length = 521 Score = 75.9 bits (185), Expect = 5e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDV+TMRAFQELRDKARSCHVQCH+Q QKL CRSA Sbjct: 482 AGGFDVDTMRAFQELRDKARSCHVQCHNQPQKLYCRSA 519 >KHN08450.1 Protein CHUP1, chloroplastic [Glycine soja] Length = 519 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSC++QCHSQQQK CRSA Sbjct: 480 AGGFDVETMRAFQELRDKARSCNLQCHSQQQKFFCRSA 517 >XP_007148061.1 hypothetical protein PHAVU_006G177200g [Phaseolus vulgaris] ESW20055.1 hypothetical protein PHAVU_006G177200g [Phaseolus vulgaris] Length = 603 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSAHY 120 AGGFDVETMRAFQELRDKARSC +QCHSQQQK CRS Y Sbjct: 564 AGGFDVETMRAFQELRDKARSCQLQCHSQQQKFFCRSTTY 603 >XP_006594558.1 PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] KRH21294.1 hypothetical protein GLYMA_13G231000 [Glycine max] Length = 615 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDVETMRAFQELRDKARSC++QCHSQQQK CRSA Sbjct: 576 AGGFDVETMRAFQELRDKARSCNLQCHSQQQKFFCRSA 613 >XP_007153708.1 hypothetical protein PHAVU_003G058200g [Phaseolus vulgaris] ESW25702.1 hypothetical protein PHAVU_003G058200g [Phaseolus vulgaris] Length = 628 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 AGGFDV+TMRAFQELRDKARSCH+QCH QQK CRSA Sbjct: 589 AGGFDVDTMRAFQELRDKARSCHIQCHGHQQKFFCRSA 626 >GAU14574.1 hypothetical protein TSUD_96380 [Trifolium subterraneum] Length = 647 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 1 AGGFDVETMRAFQELRDKARSCHVQCHSQQQKLLCRSA 114 A GFD +TMRAFQELRDKARSCHVQCH QQQK LCRSA Sbjct: 608 ASGFDADTMRAFQELRDKARSCHVQCHGQQQKFLCRSA 645