BLASTX nr result
ID: Glycyrrhiza34_contig00029072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029072 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013466532.1 NBS-LRR type disease resistance protein [Medicago... 63 1e-08 AHB79190.1 CC-NBS-LRR disease resistance protein [Cicer arietinum] 61 9e-08 XP_004498272.1 PREDICTED: uncharacterized protein LOC101492873 [... 61 9e-08 >XP_013466532.1 NBS-LRR type disease resistance protein [Medicago truncatula] KEH40573.1 NBS-LRR type disease resistance protein [Medicago truncatula] Length = 1917 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 212 VHGRLFEGNLNLGRLEVLQVEYCLMLTSMFTP 117 +HGRLFEGNLNLGR++VLQVEYC MLTSMFTP Sbjct: 866 LHGRLFEGNLNLGRIKVLQVEYCRMLTSMFTP 897 >AHB79190.1 CC-NBS-LRR disease resistance protein [Cicer arietinum] Length = 1604 Score = 60.8 bits (146), Expect = 9e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 212 VHGRLFEGNLNLGRLEVLQVEYCLMLTSMFTP 117 +HGRLFEGNLNLGR+ V QVEYC MLTSMFTP Sbjct: 785 LHGRLFEGNLNLGRITVFQVEYCRMLTSMFTP 816 >XP_004498272.1 PREDICTED: uncharacterized protein LOC101492873 [Cicer arietinum] XP_012570606.1 PREDICTED: uncharacterized protein LOC101492873 [Cicer arietinum] Length = 1800 Score = 60.8 bits (146), Expect = 9e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 212 VHGRLFEGNLNLGRLEVLQVEYCLMLTSMFTP 117 +HGRLFEGNLNLGR+ V QVEYC MLTSMFTP Sbjct: 818 LHGRLFEGNLNLGRITVFQVEYCRMLTSMFTP 849