BLASTX nr result
ID: Glycyrrhiza34_contig00028956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028956 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU16021.1 hypothetical protein TSUD_338920 [Trifolium subterran... 117 7e-29 XP_004494138.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 1e-27 XP_013450088.1 pentatricopeptide (PPR) repeat protein [Medicago ... 96 2e-21 XP_007162847.1 hypothetical protein PHAVU_001G185900g [Phaseolus... 91 9e-20 XP_016208107.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 1e-19 XP_015970386.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 2e-19 KHN18724.1 Pentatricopeptide repeat-containing protein, mitochon... 89 4e-19 KRH67836.1 hypothetical protein GLYMA_03G190300 [Glycine max] 89 6e-19 XP_003520679.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 6e-19 XP_006604612.2 PREDICTED: pentatricopeptide repeat-containing pr... 88 7e-19 KRG96121.1 hypothetical protein GLYMA_19G190700 [Glycine max] 88 1e-18 XP_014494922.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 5e-18 OIW05119.1 hypothetical protein TanjilG_02592 [Lupinus angustifo... 86 7e-18 XP_019456897.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 7e-18 KOM29222.1 hypothetical protein LR48_Vigan641s001000 [Vigna angu... 83 6e-17 XP_017409923.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 6e-17 KYP70942.1 hypothetical protein KK1_010183 [Cajanus cajan] 69 4e-12 XP_016446570.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-11 XP_009606615.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-11 KHN02264.1 Pentatricopeptide repeat-containing protein, mitochon... 67 2e-11 >GAU16021.1 hypothetical protein TSUD_338920 [Trifolium subterraneum] Length = 685 Score = 117 bits (292), Expect = 7e-29 Identities = 57/78 (73%), Positives = 63/78 (80%), Gaps = 3/78 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAFSLK MKAPY+EPN++TYNCLLSG+CGLGRLEDAR VLLEMEG G LP GF CLVF Sbjct: 132 EEAFSLKDRMKAPYSEPNIVTYNCLLSGLCGLGRLEDARSVLLEMEGKGFLPSGFSCLVF 191 Query: 48 DDQ---SSTYGSLDGNRT 4 DD ++ G LDGN T Sbjct: 192 DDHLVCANENGLLDGNGT 209 >XP_004494138.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Cicer arietinum] XP_012569495.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Cicer arietinum] Length = 773 Score = 113 bits (283), Expect = 1e-27 Identities = 54/79 (68%), Positives = 63/79 (79%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAFSLK MKAPY+EPN +TYNCLL G+CGLGRLEDAR+VL EMEGNG LPGGF ++F Sbjct: 238 EEAFSLKARMKAPYSEPNCVTYNCLLGGLCGLGRLEDARRVLQEMEGNGFLPGGFSSIIF 297 Query: 48 DDQ---SSTYGSLDGNRTR 1 DD ++ G +DGN TR Sbjct: 298 DDHLVCANKNGLIDGNGTR 316 >XP_013450088.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH24116.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 776 Score = 96.3 bits (238), Expect = 2e-21 Identities = 47/79 (59%), Positives = 59/79 (74%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 +EAF L+ M PY++ N++TYNCLLSG+CGLGRLEDA++VLLEME G LP GF LVF Sbjct: 241 DEAFRLRARMNGPYSKANVVTYNCLLSGLCGLGRLEDAKRVLLEMERKGFLPRGFSSLVF 300 Query: 48 DDQ---SSTYGSLDGNRTR 1 DDQ + G L+GN T+ Sbjct: 301 DDQLMSGNENGLLNGNGTQ 319 >XP_007162847.1 hypothetical protein PHAVU_001G185900g [Phaseolus vulgaris] ESW34841.1 hypothetical protein PHAVU_001G185900g [Phaseolus vulgaris] Length = 776 Score = 91.3 bits (225), Expect = 9e-20 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAFS K+ MK E NL+TYNCLLSG+CG GR+E+ARKVLLEMEG G+LP GFL +VF Sbjct: 245 EEAFSFKERMKELNVECNLVTYNCLLSGLCGSGRVEEARKVLLEMEGCGVLPCGFLSVVF 304 Query: 48 DDQSSTYG 25 D S+ G Sbjct: 305 DGHSNVAG 312 >XP_016208107.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Arachis ipaensis] Length = 792 Score = 90.9 bits (224), Expect = 1e-19 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAFSL++ MK A+P+L+TYN LLSG+CG GRLEDARKVLLEME G LPG FL +VF Sbjct: 258 EEAFSLRERMKTQNADPSLLTYNALLSGLCGSGRLEDARKVLLEMEAAGFLPGEFLRVVF 317 Query: 48 DDQSSTYGSL 19 DD GSL Sbjct: 318 DDDDD--GSL 325 >XP_015970386.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Arachis duranensis] Length = 792 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAFSL++ MK A+P+L+TYN LLSG+CG GRLEDARKVLLEME G LPG FL +VF Sbjct: 258 EEAFSLRERMKTQNADPSLLTYNALLSGLCGSGRLEDARKVLLEMEAAGFLPGEFLRVVF 317 Query: 48 DD 43 DD Sbjct: 318 DD 319 >KHN18724.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 590 Score = 89.4 bits (220), Expect = 4e-19 Identities = 45/79 (56%), Positives = 55/79 (69%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEA K+ MK E NL+TYN LL+G+CG GR++DAR+VLLEMEG+G LPGGFL +VF Sbjct: 57 EEALGFKERMKEQNVECNLVTYNSLLNGLCGSGRVDDAREVLLEMEGSGFLPGGFLSVVF 116 Query: 48 DDQSSTYGS---LDGNRTR 1 DD S+ G DG R Sbjct: 117 DDHSNGAGDDGLFDGKEIR 135 >KRH67836.1 hypothetical protein GLYMA_03G190300 [Glycine max] Length = 677 Score = 89.0 bits (219), Expect = 6e-19 Identities = 45/79 (56%), Positives = 54/79 (68%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEA K+ MK E NL+TYN LL+G+CG GR++DAR+VLLEMEG+G LPGGFL VF Sbjct: 244 EEALGFKERMKEQNVECNLVTYNSLLNGLCGSGRVDDAREVLLEMEGSGFLPGGFLSFVF 303 Query: 48 DDQSSTYGS---LDGNRTR 1 DD S+ G DG R Sbjct: 304 DDHSNGAGDDGLFDGKEIR 322 >XP_003520679.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Glycine max] XP_006577051.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Glycine max] XP_014629384.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Glycine max] KRH67834.1 hypothetical protein GLYMA_03G190300 [Glycine max] KRH67835.1 hypothetical protein GLYMA_03G190300 [Glycine max] Length = 777 Score = 89.0 bits (219), Expect = 6e-19 Identities = 45/79 (56%), Positives = 54/79 (68%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEA K+ MK E NL+TYN LL+G+CG GR++DAR+VLLEMEG+G LPGGFL VF Sbjct: 244 EEALGFKERMKEQNVECNLVTYNSLLNGLCGSGRVDDAREVLLEMEGSGFLPGGFLSFVF 303 Query: 48 DDQSSTYGS---LDGNRTR 1 DD S+ G DG R Sbjct: 304 DDHSNGAGDDGLFDGKEIR 322 >XP_006604612.2 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Glycine max] XP_006604615.2 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Glycine max] XP_006604613.2 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Glycine max] XP_006604614.2 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Glycine max] Length = 409 Score = 88.2 bits (217), Expect = 7e-19 Identities = 44/79 (55%), Positives = 54/79 (68%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAF K+ M+ E NL+TYN LL+G+CG GR+EDA++VLLEME +G LPGGFL VF Sbjct: 265 EEAFGFKERMREQNVECNLVTYNSLLNGLCGSGRVEDAKEVLLEMEDSGFLPGGFLSFVF 324 Query: 48 DDQSSTYGS---LDGNRTR 1 DD S+ G DG R Sbjct: 325 DDHSNVAGDDSLFDGKEIR 343 >KRG96121.1 hypothetical protein GLYMA_19G190700 [Glycine max] Length = 782 Score = 88.2 bits (217), Expect = 1e-18 Identities = 44/79 (55%), Positives = 54/79 (68%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAF K+ M+ E NL+TYN LL+G+CG GR+EDA++VLLEME +G LPGGFL VF Sbjct: 265 EEAFGFKERMREQNVECNLVTYNSLLNGLCGSGRVEDAKEVLLEMEDSGFLPGGFLSFVF 324 Query: 48 DDQSSTYGS---LDGNRTR 1 DD S+ G DG R Sbjct: 325 DDHSNVAGDDSLFDGKEIR 343 >XP_014494922.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Vigna radiata var. radiata] XP_014494923.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Vigna radiata var. radiata] Length = 778 Score = 86.3 bits (212), Expect = 5e-18 Identities = 45/79 (56%), Positives = 53/79 (67%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAF K+ MK E NL+TYNCLL+G+C GR+EDAR+VLLEMEG G LP GFL +VF Sbjct: 245 EEAFGFKERMKQLNVECNLVTYNCLLNGLCASGRMEDAREVLLEMEGCGFLPCGFLSVVF 304 Query: 48 DDQSSTYGS---LDGNRTR 1 D S+ G DG R Sbjct: 305 DGHSNGAGDRGLFDGKEIR 323 >OIW05119.1 hypothetical protein TanjilG_02592 [Lupinus angustifolius] Length = 833 Score = 85.9 bits (211), Expect = 7e-18 Identities = 42/74 (56%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 +E F LK+ MK+ E N++TYN LL+G+C GR+ED RKVLLEME NG LP GF C++F Sbjct: 143 DEGFRLKERMKSEDVEANVVTYNTLLTGLCDSGRMEDVRKVLLEMEVNGFLPDGFSCVIF 202 Query: 48 DDQ-SSTYGSLDGN 10 DD+ SS +LD N Sbjct: 203 DDRHSSDNAALDEN 216 >XP_019456897.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Lupinus angustifolius] XP_019456898.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Lupinus angustifolius] Length = 932 Score = 85.9 bits (211), Expect = 7e-18 Identities = 42/74 (56%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 +E F LK+ MK+ E N++TYN LL+G+C GR+ED RKVLLEME NG LP GF C++F Sbjct: 242 DEGFRLKERMKSEDVEANVVTYNTLLTGLCDSGRMEDVRKVLLEMEVNGFLPDGFSCVIF 301 Query: 48 DDQ-SSTYGSLDGN 10 DD+ SS +LD N Sbjct: 302 DDRHSSDNAALDEN 315 >KOM29222.1 hypothetical protein LR48_Vigan641s001000 [Vigna angularis] Length = 777 Score = 83.2 bits (204), Expect = 6e-17 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAF K+ MK E +L+TYNCLL+G+C GR+EDAR++LLEMEG G LP GFL +VF Sbjct: 244 EEAFGFKERMKQLNVECSLVTYNCLLNGLCASGRMEDAREMLLEMEGCGFLPCGFLSVVF 303 Query: 48 DDQSSTYGS---LDGNRTR 1 D S+ G DG R Sbjct: 304 DGHSNGAGDRGLFDGKEIR 322 >XP_017409923.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Vigna angularis] BAT85809.1 hypothetical protein VIGAN_04339800 [Vigna angularis var. angularis] Length = 778 Score = 83.2 bits (204), Expect = 6e-17 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 3/79 (3%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGFLCLVF 49 EEAF K+ MK E +L+TYNCLL+G+C GR+EDAR++LLEMEG G LP GFL +VF Sbjct: 245 EEAFGFKERMKQLNVECSLVTYNCLLNGLCASGRMEDAREMLLEMEGCGFLPCGFLSVVF 304 Query: 48 DDQSSTYGS---LDGNRTR 1 D S+ G DG R Sbjct: 305 DGHSNGAGDRGLFDGKEIR 323 >KYP70942.1 hypothetical protein KK1_010183 [Cajanus cajan] Length = 614 Score = 69.3 bits (168), Expect = 4e-12 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEME-GNGLLP 73 EEAF KK MK N+ITYNCLL+G+CGLGR+EDAR+VLLEME NG+ P Sbjct: 143 EEAFGFKKRMKEHNVGCNVITYNCLLNGLCGLGRVEDAREVLLEMEVDNGVAP 195 >XP_016446570.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Nicotiana tabacum] Length = 811 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGF-LCLV 52 EEAF L++ MK+ EPN++T+N LLSG+C LG++E+A V+ EM+G G +P GF ++ Sbjct: 256 EEAFKLREKMKSDNVEPNIVTFNTLLSGLCKLGKMEEANCVVEEMKGYGFVPDGFTYSIL 315 Query: 51 FDDQS 37 FD S Sbjct: 316 FDGHS 320 >XP_009606615.1 PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Nicotiana tomentosiformis] Length = 811 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLPGGF-LCLV 52 EEAF L++ MK+ EPN++T+N LLSG+C LG++E+A V+ EM+G G +P GF ++ Sbjct: 256 EEAFKLREKMKSDNVEPNIVTFNTLLSGLCKLGKMEEANCVVEEMKGYGFVPDGFTYSIL 315 Query: 51 FDDQS 37 FD S Sbjct: 316 FDGHS 320 >KHN02264.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 546 Score = 67.4 bits (163), Expect = 2e-11 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -2 Query: 228 EEAFSLKKSMKAPYAEPNLITYNCLLSGVCGLGRLEDARKVLLEMEGNGLLP 73 EEAF K+ M+ E NL+TYN LL+G+CG GR+EDA++VLLEME +G LP Sbjct: 132 EEAFGFKERMREQNVECNLVTYNSLLNGLCGSGRVEDAKEVLLEMEDSGFLP 183