BLASTX nr result
ID: Glycyrrhiza34_contig00028905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028905 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN05714.1 Interactor of constitutive active ROPs 3 [Glycine soja] 166 2e-46 XP_006592232.1 PREDICTED: interactor of constitutive active ROPs... 166 2e-46 XP_003539735.1 PREDICTED: interactor of constitutive active ROPs... 166 2e-46 XP_014628594.1 PREDICTED: interactor of constitutive active ROPs... 165 8e-46 XP_003538038.1 PREDICTED: interactor of constitutive active ROPs... 165 8e-46 KRG89052.1 hypothetical protein GLYMA_U021100 [Glycine max] 165 8e-46 KHN22038.1 Interactor of constitutive active ROPs 3 [Glycine soja] 163 3e-45 KYP68469.1 Interactor of constitutive active ROPs 3 [Cajanus cajan] 151 2e-40 OIW05789.1 hypothetical protein TanjilG_23575 [Lupinus angustifo... 146 4e-39 XP_019453993.1 PREDICTED: interactor of constitutive active ROPs... 146 5e-39 GAU14647.1 hypothetical protein TSUD_97110 [Trifolium subterraneum] 141 5e-37 XP_007132172.1 hypothetical protein PHAVU_011G072000g [Phaseolus... 138 4e-36 XP_013456038.1 interactor of constitutive active ROPs-like prote... 128 3e-32 XP_013456037.1 interactor of constitutive active ROPs-like prote... 128 3e-32 XP_019413966.1 PREDICTED: interactor of constitutive active ROPs... 125 2e-31 XP_007150230.1 hypothetical protein PHAVU_005G137600g [Phaseolus... 125 2e-31 XP_019413963.1 PREDICTED: interactor of constitutive active ROPs... 125 2e-31 XP_019413957.1 PREDICTED: interactor of constitutive active ROPs... 125 2e-31 XP_019448680.1 PREDICTED: interactor of constitutive active ROPs... 125 3e-31 XP_004505951.1 PREDICTED: interactor of constitutive active ROPs... 124 5e-31 >KHN05714.1 Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 166 bits (421), Expect = 2e-46 Identities = 81/110 (73%), Positives = 97/110 (88%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+Q+R+CKESEAQAQ LVNET +QLEAAKGTVE LRADVA+AVDGYNS+ALELDQS+AR Sbjct: 222 LKNQVRDCKESEAQAQALVNETTVQLEAAKGTVEFLRADVARAVDGYNSVALELDQSKAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVSK++ D INNKC N+ DDHK E +PE LKEGEDPNQ+E+ Sbjct: 282 VNSLEALVSKIEKDPINNKCIPSENVADDHKSEHQPEILKEGEDPNQLEA 331 >XP_006592232.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Glycine max] KRH24941.1 hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 166 bits (421), Expect = 2e-46 Identities = 81/110 (73%), Positives = 97/110 (88%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+Q+R+CKESEAQAQ LVNET +QLEAAKGTVE LRADVA+AVDGYNS+ALELDQS+AR Sbjct: 222 LKNQVRDCKESEAQAQALVNETTVQLEAAKGTVEFLRADVARAVDGYNSVALELDQSKAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVSK++ D INNKC N+ DDHK E +PE LKEGEDPNQ+E+ Sbjct: 282 VNSLEALVSKIEKDPINNKCIPSENVADDHKSEHQPEILKEGEDPNQLEA 331 >XP_003539735.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_003539736.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592228.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592229.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592230.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_006592231.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] XP_014620044.1 PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] KRH24934.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24935.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24936.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24937.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24938.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24939.1 hypothetical protein GLYMA_12G072200 [Glycine max] KRH24940.1 hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 166 bits (421), Expect = 2e-46 Identities = 81/110 (73%), Positives = 97/110 (88%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+Q+R+CKESEAQAQ LVNET +QLEAAKGTVE LRADVA+AVDGYNS+ALELDQS+AR Sbjct: 222 LKNQVRDCKESEAQAQALVNETTVQLEAAKGTVEFLRADVARAVDGYNSVALELDQSKAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVSK++ D INNKC N+ DDHK E +PE LKEGEDPNQ+E+ Sbjct: 282 VNSLEALVSKIEKDPINNKCIPSENVADDHKSEHQPEILKEGEDPNQLEA 331 >XP_014628594.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Glycine max] KRG89053.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89054.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89055.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89056.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 165 bits (417), Expect = 8e-46 Identities = 82/110 (74%), Positives = 96/110 (87%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+QLR+CKESEAQAQ LVNET++QLEAAKGTVE LRADVAKAVDGYNSIA ELDQS AR Sbjct: 222 LKNQLRDCKESEAQAQALVNETMMQLEAAKGTVEFLRADVAKAVDGYNSIAKELDQSEAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVS L+TD INNKC N+ DDHK E +PE LK+GEDP+Q+E+ Sbjct: 282 VNSLEALVSNLETDPINNKCILSENVADDHKFEYQPEILKQGEDPSQLEA 331 >XP_003538038.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_006591017.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_006591018.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] XP_014628595.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] KRG89046.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89047.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89048.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89049.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89050.1 hypothetical protein GLYMA_U021100 [Glycine max] KRG89051.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 165 bits (417), Expect = 8e-46 Identities = 82/110 (74%), Positives = 96/110 (87%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+QLR+CKESEAQAQ LVNET++QLEAAKGTVE LRADVAKAVDGYNSIA ELDQS AR Sbjct: 222 LKNQLRDCKESEAQAQALVNETMMQLEAAKGTVEFLRADVAKAVDGYNSIAKELDQSEAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVS L+TD INNKC N+ DDHK E +PE LK+GEDP+Q+E+ Sbjct: 282 VNSLEALVSNLETDPINNKCILSENVADDHKFEYQPEILKQGEDPSQLEA 331 >KRG89052.1 hypothetical protein GLYMA_U021100 [Glycine max] Length = 617 Score = 165 bits (417), Expect = 8e-46 Identities = 82/110 (74%), Positives = 96/110 (87%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+QLR+CKESEAQAQ LVNET++QLEAAKGTVE LRADVAKAVDGYNSIA ELDQS AR Sbjct: 224 LKNQLRDCKESEAQAQALVNETMMQLEAAKGTVEFLRADVAKAVDGYNSIAKELDQSEAR 283 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+ALVS L+TD INNKC N+ DDHK E +PE LK+GEDP+Q+E+ Sbjct: 284 VNSLEALVSNLETDPINNKCILSENVADDHKFEYQPEILKQGEDPSQLEA 333 >KHN22038.1 Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 163 bits (413), Expect = 3e-45 Identities = 81/110 (73%), Positives = 95/110 (86%) Frame = +2 Query: 8 MKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRAR 187 +K+QLR+CKESEAQAQ LVNET++QLEAAKGTVE LRADVAKAVDGYNSIA ELDQS AR Sbjct: 222 LKNQLRDCKESEAQAQALVNETMMQLEAAKGTVEFLRADVAKAVDGYNSIAKELDQSEAR 281 Query: 188 VNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 VN+L+A VS L+TD INNKC N+ DDHK E +PE LK+GEDP+Q+E+ Sbjct: 282 VNSLEAFVSNLETDPINNKCILSENVADDHKFEYQPEILKQGEDPSQLEA 331 >KYP68469.1 Interactor of constitutive active ROPs 3 [Cajanus cajan] Length = 721 Score = 151 bits (381), Expect = 2e-40 Identities = 78/112 (69%), Positives = 92/112 (82%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 +NMK+QL +CKESEAQAQ LVNET+LQLE AKGTVE+LR+DVAKAVDGYNSIALELDQS+ Sbjct: 250 DNMKNQLMDCKESEAQAQALVNETMLQLEDAKGTVELLRSDVAKAVDGYNSIALELDQSK 309 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 RVN+L+ LV KL+T INNK + DDH E +PE LKEGED NQ+E+ Sbjct: 310 MRVNSLEELVGKLETHPINNKSAPSEK--DDHNFEHQPEILKEGEDTNQLEA 359 >OIW05789.1 hypothetical protein TanjilG_23575 [Lupinus angustifolius] Length = 597 Score = 146 bits (369), Expect = 4e-39 Identities = 73/112 (65%), Positives = 90/112 (80%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 E+M++QLRNCKESE+Q Q L+NETLLQLEAAK +E+L AD AK++D YNSIALELDQSR Sbjct: 201 ESMENQLRNCKESESQPQDLINETLLQLEAAKKAMELLHADAAKSLDAYNSIALELDQSR 260 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 ARVN+L+ALV L+ D I+N+ NL DH QEPE+LKE EDPNQ+E+ Sbjct: 261 ARVNSLEALVRNLEADLISNEGIQSQNLASDHIFSQEPERLKEDEDPNQVEA 312 >XP_019453993.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453994.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453995.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453996.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453998.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] XP_019453999.1 PREDICTED: interactor of constitutive active ROPs 3 [Lupinus angustifolius] Length = 616 Score = 146 bits (369), Expect = 5e-39 Identities = 73/112 (65%), Positives = 90/112 (80%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 E+M++QLRNCKESE+Q Q L+NETLLQLEAAK +E+L AD AK++D YNSIALELDQSR Sbjct: 220 ESMENQLRNCKESESQPQDLINETLLQLEAAKKAMELLHADAAKSLDAYNSIALELDQSR 279 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 ARVN+L+ALV L+ D I+N+ NL DH QEPE+LKE EDPNQ+E+ Sbjct: 280 ARVNSLEALVRNLEADLISNEGIQSQNLASDHIFSQEPERLKEDEDPNQVEA 331 >GAU14647.1 hypothetical protein TSUD_97110 [Trifolium subterraneum] Length = 616 Score = 141 bits (355), Expect = 5e-37 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 1/112 (0%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 ENMK+QL+NCKE E+Q Q +V+ETLLQLE+AK TVEILR DVAK +DGYN+++ EL+QSR Sbjct: 220 ENMKNQLKNCKEPESQTQDIVDETLLQLESAKRTVEILRDDVAKDIDGYNTVSSELEQSR 279 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGN-LVDDHKLEQEPEKLKEGEDPNQIE 334 ARVNTL LVSKLKT +N+ LVDD K E+EPE LK+GE+PNQIE Sbjct: 280 ARVNTLVTLVSKLKTHINDNESVHSDQYLVDDRKFEKEPEMLKDGEEPNQIE 331 >XP_007132172.1 hypothetical protein PHAVU_011G072000g [Phaseolus vulgaris] ESW04166.1 hypothetical protein PHAVU_011G072000g [Phaseolus vulgaris] Length = 604 Score = 138 bits (348), Expect = 4e-36 Identities = 76/112 (67%), Positives = 89/112 (79%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 + MKSQLR+ KESEAQAQ LVNET+LQ EAAK T+EILRADVAKAVDGYN+IALELDQS+ Sbjct: 220 DTMKSQLRDYKESEAQAQALVNETMLQREAAKTTIEILRADVAKAVDGYNTIALELDQSK 279 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 ARVN+L+ALVS L+TDSI+N K E +PE LKEGED N +E+ Sbjct: 280 ARVNSLEALVSILQTDSISN------------KFEHQPEILKEGEDSNDLEA 319 >XP_013456038.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] KEH30069.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 617 Score = 128 bits (321), Expect = 3e-32 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (0%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 ENMK+QL+N KE E +AQ ++ETLLQLE+AK TVEILR DV + VDGYNSIALEL+ SR Sbjct: 220 ENMKNQLKNSKEPETRAQIFIDETLLQLESAKRTVEILRDDVVRDVDGYNSIALELEHSR 279 Query: 182 ARVNTLDALVSKLKTD-SINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIE 334 ARVNTL LVSK KT + N NLVDD K E+E E L+ GE+PN IE Sbjct: 280 ARVNTLATLVSKFKTRINDNEPIHSDQNLVDDCKFEKESEILRNGEEPNHIE 331 >XP_013456037.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] KEH30068.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 620 Score = 128 bits (321), Expect = 3e-32 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (0%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 ENMK+QL+N KE E +AQ ++ETLLQLE+AK TVEILR DV + VDGYNSIALEL+ SR Sbjct: 223 ENMKNQLKNSKEPETRAQIFIDETLLQLESAKRTVEILRDDVVRDVDGYNSIALELEHSR 282 Query: 182 ARVNTLDALVSKLKTD-SINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIE 334 ARVNTL LVSK KT + N NLVDD K E+E E L+ GE+PN IE Sbjct: 283 ARVNTLATLVSKFKTRINDNEPIHSDQNLVDDCKFEKESEILRNGEEPNHIE 334 >XP_019413966.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X3 [Lupinus angustifolius] Length = 604 Score = 125 bits (315), Expect = 2e-31 Identities = 67/109 (61%), Positives = 82/109 (75%) Frame = +2 Query: 5 NMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRA 184 +MK+Q RN K SE+QAQ L+ E+LLQLEAAK VE L AD AKAVD YNSIALELDQSRA Sbjct: 208 SMKNQPRNYKASESQAQDLIYESLLQLEAAKKAVEFLHADAAKAVDTYNSIALELDQSRA 267 Query: 185 RVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQI 331 +VN+L+A + KL+ D I+N+ NL DHK +EPE L+E ED NQ+ Sbjct: 268 QVNSLEATIRKLEADLISNEGIQSRNLAADHKFRKEPECLEEDEDRNQV 316 >XP_007150230.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] XP_007150231.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] XP_007150232.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] XP_007150233.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ESW22224.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ESW22225.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ESW22226.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ESW22227.1 hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] Length = 613 Score = 125 bits (315), Expect = 2e-31 Identities = 69/112 (61%), Positives = 84/112 (75%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 ENMK+QLR+ KES QAQ LVNETL QLEAAK TVE LR+D AKA+ GYNS A ELDQSR Sbjct: 220 ENMKNQLRDSKES-GQAQALVNETLRQLEAAKRTVEFLRSDAAKALHGYNSAASELDQSR 278 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIES 337 RV++L+ LVSKL+ I NKC+ N+ DD +E + E L +GEDPN+ E+ Sbjct: 279 TRVDSLETLVSKLEFGLIRNKCNHSINVADDRIMELKAEILHKGEDPNRTEA 330 >XP_019413963.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Lupinus angustifolius] XP_019413965.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Lupinus angustifolius] Length = 616 Score = 125 bits (315), Expect = 2e-31 Identities = 67/109 (61%), Positives = 82/109 (75%) Frame = +2 Query: 5 NMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRA 184 +MK+Q RN K SE+QAQ L+ E+LLQLEAAK VE L AD AKAVD YNSIALELDQSRA Sbjct: 220 SMKNQPRNYKASESQAQDLIYESLLQLEAAKKAVEFLHADAAKAVDTYNSIALELDQSRA 279 Query: 185 RVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQI 331 +VN+L+A + KL+ D I+N+ NL DHK +EPE L+E ED NQ+ Sbjct: 280 QVNSLEATIRKLEADLISNEGIQSRNLAADHKFRKEPECLEEDEDRNQV 328 >XP_019413957.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413958.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413959.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413960.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413961.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] XP_019413962.1 PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Lupinus angustifolius] OIV99349.1 hypothetical protein TanjilG_17159 [Lupinus angustifolius] Length = 617 Score = 125 bits (315), Expect = 2e-31 Identities = 67/109 (61%), Positives = 82/109 (75%) Frame = +2 Query: 5 NMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSRA 184 +MK+Q RN K SE+QAQ L+ E+LLQLEAAK VE L AD AKAVD YNSIALELDQSRA Sbjct: 221 SMKNQPRNYKASESQAQDLIYESLLQLEAAKKAVEFLHADAAKAVDTYNSIALELDQSRA 280 Query: 185 RVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQI 331 +VN+L+A + KL+ D I+N+ NL DHK +EPE L+E ED NQ+ Sbjct: 281 QVNSLEATIRKLEADLISNEGIQSRNLAADHKFRKEPECLEEDEDRNQV 329 >XP_019448680.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448681.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448682.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448683.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448684.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448685.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] XP_019448686.1 PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] OIW08590.1 hypothetical protein TanjilG_03266 [Lupinus angustifolius] Length = 617 Score = 125 bits (314), Expect = 3e-31 Identities = 66/111 (59%), Positives = 81/111 (72%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 E+MK+Q R C ESE+QAQ L+NETL QLEA + VE+L AD KAVD NSIALELD SR Sbjct: 220 ESMKNQPRICNESESQAQDLLNETLFQLEATEKAVEVLHADATKAVDASNSIALELDHSR 279 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIE 334 ARVN+L+ALV KL+ I+N+ N DDHK EPE+L++ ED NQ+E Sbjct: 280 ARVNSLEALVRKLEAGLISNEGIQSQNFGDDHKFGLEPERLRKDEDHNQVE 330 >XP_004505951.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_004505952.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_012572777.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] XP_012572778.1 PREDICTED: interactor of constitutive active ROPs 3 [Cicer arietinum] Length = 611 Score = 124 bits (312), Expect = 5e-31 Identities = 71/111 (63%), Positives = 82/111 (73%) Frame = +2 Query: 2 ENMKSQLRNCKESEAQAQTLVNETLLQLEAAKGTVEILRADVAKAVDGYNSIALELDQSR 181 E MK+QL+ KESE +AQ V+ET LQLEAAK TV+ILRADVAK VDGYNSIALELDQSR Sbjct: 227 EYMKNQLKISKESEGEAQAFVDETSLQLEAAKRTVDILRADVAKDVDGYNSIALELDQSR 286 Query: 182 ARVNTLDALVSKLKTDSINNKCSDCGNLVDDHKLEQEPEKLKEGEDPNQIE 334 RVNTL LVSKLK D +N+ V+DHK ++EGEDPNQI+ Sbjct: 287 ERVNTLGKLVSKLKIDINDNESIRSEYFVEDHKF------VEEGEDPNQIK 331