BLASTX nr result
ID: Glycyrrhiza34_contig00028694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028694 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012574550.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 6e-12 KRH28556.1 hypothetical protein GLYMA_11G061600 [Glycine max] 67 2e-11 KYP66694.1 hypothetical protein KK1_013000 [Cajanus cajan] 67 4e-11 XP_003516589.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 5e-11 XP_007156866.1 hypothetical protein PHAVU_002G024100g [Phaseolus... 66 7e-11 XP_003611862.1 PPR containing protein [Medicago truncatula] AES9... 65 2e-10 XP_019422034.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 8e-10 XP_014519605.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-09 XP_015964018.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 7e-09 XP_017426774.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 7e-09 XP_008241871.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 4e-06 GAV68261.1 PPR domain-containing protein/PPR_2 domain-containing... 52 5e-06 >XP_012574550.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cicer arietinum] Length = 652 Score = 68.9 bits (167), Expect = 6e-12 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 114 DLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 +LKSPTHQ LHCLIDQC SL+QLKLVHA IILHGLA Sbjct: 24 ELKSPTHQTLHCLIDQCISLKQLKLVHAQIILHGLA 59 >KRH28556.1 hypothetical protein GLYMA_11G061600 [Glycine max] Length = 610 Score = 67.4 bits (163), Expect = 2e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 93 SKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 +K IW + LKSP+HQ LH L+DQCFS+RQLKLVHA IILHGLA Sbjct: 27 NKIIWHQ-LKSPSHQTLHHLLDQCFSMRQLKLVHAQIILHGLA 68 >KYP66694.1 hypothetical protein KK1_013000 [Cajanus cajan] Length = 632 Score = 66.6 bits (161), Expect = 4e-11 Identities = 34/61 (55%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = +3 Query: 45 GTNACWFQFQNGGHQN--SKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGL 218 G+ WF Q SK IW + LKSPTHQ LH L+DQC S+RQLK++H+ IILHGL Sbjct: 13 GSRLFWFSSLQSQTQTQISKNIWHK-LKSPTHQTLHHLLDQCSSIRQLKILHSQIILHGL 71 Query: 219 A 221 A Sbjct: 72 A 72 >XP_003516589.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Glycine max] KRH76907.1 hypothetical protein GLYMA_01G180600 [Glycine max] Length = 667 Score = 66.2 bits (160), Expect = 5e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 87 QNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 Q +KTIW + LKSPTHQ LH L+DQC S+++LKLVHA IILHGLA Sbjct: 25 QINKTIWHQ-LKSPTHQTLHHLLDQCSSMKRLKLVHAQIILHGLA 68 >XP_007156866.1 hypothetical protein PHAVU_002G024100g [Phaseolus vulgaris] ESW28860.1 hypothetical protein PHAVU_002G024100g [Phaseolus vulgaris] Length = 667 Score = 65.9 bits (159), Expect = 7e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +3 Query: 87 QNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 Q SKTIW + LKSPTHQ LH L+DQ SLRQLK+VHA +ILHGLA Sbjct: 25 QISKTIWHK-LKSPTHQTLHHLLDQSSSLRQLKIVHAQLILHGLA 68 >XP_003611862.1 PPR containing protein [Medicago truncatula] AES94820.1 PPR containing protein [Medicago truncatula] Length = 663 Score = 64.7 bits (156), Expect = 2e-10 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +3 Query: 87 QNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 Q SKTI + +LKSPTHQ LH LIDQC SL+QLK VHA IILHGLA Sbjct: 22 QISKTILQ-ELKSPTHQTLHYLIDQCISLKQLKHVHAQIILHGLA 65 >XP_019422034.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Lupinus angustifolius] Length = 662 Score = 62.8 bits (151), Expect = 8e-10 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = +3 Query: 36 KQAGTNACWFQFQNGGHQNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHG 215 K A + F + Q +K IW +LKSP HQ LH LI+QC S+RQLKL+HA IILHG Sbjct: 6 KHATVGSRLFSIHSFQTQITKNIWH-NLKSPIHQTLHYLIEQCSSMRQLKLLHAQIILHG 64 Query: 216 L 218 L Sbjct: 65 L 65 >XP_014519605.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vigna radiata var. radiata] Length = 667 Score = 62.0 bits (149), Expect = 2e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +3 Query: 87 QNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 Q S TIW + LKSPTHQ LH L+D+ S RQLKLVHA IILHGLA Sbjct: 25 QISTTIWHK-LKSPTHQTLHHLLDKSTSFRQLKLVHAQIILHGLA 68 >XP_015964018.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Arachis duranensis] Length = 614 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = +3 Query: 90 NSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLAG 224 +++TIW + KSPTHQ LH L+++C S+R+LKL+HA ILHGL+G Sbjct: 19 SAQTIWH-NFKSPTHQTLHLLLERCSSMRELKLLHAQTILHGLSG 62 >XP_017426774.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vigna angularis] KOM45080.1 hypothetical protein LR48_Vigan06g038600 [Vigna angularis] Length = 667 Score = 60.1 bits (144), Expect = 7e-09 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = +3 Query: 87 QNSKTIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGLA 221 Q S TIW + LKSPTHQ LH L+DQ S RQLKLVHA IIL GLA Sbjct: 25 QISTTIWHK-LKSPTHQTLHHLLDQSISFRQLKLVHAQIILLGLA 68 >XP_008241871.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Prunus mume] Length = 669 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 99 TIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGL 218 T + ++ KSPTHQ LH L++QC S+R+LK +HA IILH L Sbjct: 33 TNFTQNFKSPTHQTLHHLLEQCSSMRELKQLHAQIILHSL 72 >GAV68261.1 PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 657 Score = 52.0 bits (123), Expect = 5e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +3 Query: 99 TIWRRDLKSPTHQALHCLIDQCFSLRQLKLVHAHIILHGL 218 ++ + KS THQ+LH L+D+CFS+ QL +HA IILHGL Sbjct: 21 SVLTKTFKSSTHQSLHLLLDKCFSMTQLYQIHAQIILHGL 60