BLASTX nr result
ID: Glycyrrhiza34_contig00028574
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028574 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006840151.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa... 72 2e-14 OMP05690.1 Ubiquitin-conjugating enzyme/RWD-like protein [Corcho... 72 3e-14 XP_020169207.1 ubiquitin-conjugating enzyme E2 28-like [Aegilops... 72 3e-14 EMS48847.1 Ubiquitin-conjugating enzyme E2 28 [Triticum urartu] 72 3e-14 BAK00143.1 predicted protein [Hordeum vulgare subsp. vulgare] 72 3e-14 AAM08932.1 ubiquitin conjugating-like enzyme, partial [Malus dom... 69 4e-14 XP_009927756.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa... 69 4e-14 KFP93052.1 Ubiquitin-conjugating enzyme E2-17 kDa, partial [Hali... 69 4e-14 BAF06555.1 Os01g0819500, partial [Oryza sativa Japonica Group] B... 69 6e-14 KDQ58597.1 hypothetical protein JAAARDRAFT_176604 [Jaapia argill... 71 6e-14 NP_001275336.1 ubiquitin-conjugating enzyme E2-17 kDa-like [Sola... 70 6e-14 XP_006652984.1 PREDICTED: ubiquitin-conjugating enzyme E2 28 [Or... 71 6e-14 KJB39129.1 hypothetical protein B456_007G025200 [Gossypium raimo... 70 6e-14 XP_006452757.1 hypothetical protein CICLE_v10009806mg [Citrus cl... 70 6e-14 AAR83898.1 ubiquitin-conjugating protein [Capsicum annuum] 70 6e-14 KVI10301.1 Ubiquitin-conjugating enzyme, active site-containing ... 72 6e-14 BAF19636.2 Os06g0506600, partial [Oryza sativa Japonica Group] 69 6e-14 KRG97124.1 hypothetical protein GLYMA_19G2530001, partial [Glyci... 69 6e-14 KHG30069.1 Ubiquitin-conjugating enzyme E2-17 kDa [Gossypium arb... 70 8e-14 CAA06493.1 Ubiquitin conjugating enzyme, partial [Cicer arietinum] 69 8e-14 >XP_006840151.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Amborella trichopoda] XP_011621815.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Amborella trichopoda] XP_011621816.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Amborella trichopoda] XP_011621817.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Amborella trichopoda] ERN01826.1 hypothetical protein AMTR_s00089p00061940 [Amborella trichopoda] Length = 148 Score = 72.4 bits (176), Expect = 2e-14 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YKNDRA YETTA+ WT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKNDRAKYETTARTWTQKYAM 147 >OMP05690.1 Ubiquitin-conjugating enzyme/RWD-like protein [Corchorus olitorius] Length = 148 Score = 72.0 bits (175), Expect = 3e-14 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+AQ YKNDRA YE+TA++WT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAQTYKNDRAKYESTARSWTQKYAM 147 >XP_020169207.1 ubiquitin-conjugating enzyme E2 28-like [Aegilops tauschii subsp. tauschii] EMT23617.1 Ubiquitin carrier protein E2 28 [Aegilops tauschii] Length = 148 Score = 72.0 bits (175), Expect = 3e-14 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+AQLYKN RA YE TA+AWT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAQLYKNQRARYEDTARAWTQKYAM 147 >EMS48847.1 Ubiquitin-conjugating enzyme E2 28 [Triticum urartu] Length = 148 Score = 72.0 bits (175), Expect = 3e-14 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+AQLYKN RA YE TA+AWT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAQLYKNQRARYEETARAWTQKYAM 147 >BAK00143.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 148 Score = 72.0 bits (175), Expect = 3e-14 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+AQLYKN RA YE TA+AWT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAQLYKNQRARYEDTARAWTQKYAM 147 >AAM08932.1 ubiquitin conjugating-like enzyme, partial [Malus domestica] Length = 42 Score = 68.9 bits (167), Expect = 4e-14 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YE+TA++WT+KYAM Sbjct: 2 SLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAM 41 >XP_009927756.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa, partial [Haliaeetus albicilla] Length = 63 Score = 69.3 bits (168), Expect = 4e-14 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK+DR YETTA++WT+KYAM Sbjct: 23 SLLTDPNPDDPLVPEIAHMYKSDRTKYETTARSWTQKYAM 62 >KFP93052.1 Ubiquitin-conjugating enzyme E2-17 kDa, partial [Haliaeetus albicilla] Length = 64 Score = 69.3 bits (168), Expect = 4e-14 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK+DR YETTA++WT+KYAM Sbjct: 25 SLLTDPNPDDPLVPEIAHMYKSDRTKYETTARSWTQKYAM 64 >BAF06555.1 Os01g0819500, partial [Oryza sativa Japonica Group] BAS74959.1 Os01g0819500, partial [Oryza sativa Japonica Group] Length = 47 Score = 68.6 bits (166), Expect = 6e-14 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DR YETTA++WT+KYAM Sbjct: 7 SLLTDPNPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAM 46 >KDQ58597.1 hypothetical protein JAAARDRAFT_176604 [Jaapia argillacea MUCL 33604] Length = 147 Score = 71.2 bits (173), Expect = 6e-14 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 S+LTDPN +DPLVPE+AQLYK DRA YE TA+ WTRKYAM Sbjct: 108 SMLTDPNPDDPLVPEIAQLYKTDRARYEATAREWTRKYAM 147 >NP_001275336.1 ubiquitin-conjugating enzyme E2-17 kDa-like [Solanum tuberosum] ABB86260.1 ubiquitin-conjugating protein-like [Solanum tuberosum] Length = 118 Score = 70.5 bits (171), Expect = 6e-14 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YETTA++WT+KYAM Sbjct: 78 SLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 117 >XP_006652984.1 PREDICTED: ubiquitin-conjugating enzyme E2 28 [Oryza brachyantha] XP_006652985.1 PREDICTED: ubiquitin-conjugating enzyme E2 28 [Oryza brachyantha] Length = 148 Score = 71.2 bits (173), Expect = 6e-14 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YKNDRA YE+TA++WT+KYAM Sbjct: 108 SLLTDPNPDDPLVPEIAHMYKNDRAKYESTARSWTQKYAM 147 >KJB39129.1 hypothetical protein B456_007G025200 [Gossypium raimondii] Length = 119 Score = 70.5 bits (171), Expect = 6e-14 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YETTA++WT+KYAM Sbjct: 79 SLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 118 >XP_006452757.1 hypothetical protein CICLE_v10009806mg [Citrus clementina] XP_006474770.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform X2 [Citrus sinensis] ESR65997.1 hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 119 Score = 70.5 bits (171), Expect = 6e-14 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YETTA++WT+KYAM Sbjct: 79 SLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 118 >AAR83898.1 ubiquitin-conjugating protein [Capsicum annuum] Length = 119 Score = 70.5 bits (171), Expect = 6e-14 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YETTA++WT+KYAM Sbjct: 79 SLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 118 >KVI10301.1 Ubiquitin-conjugating enzyme, active site-containing protein [Cynara cardunculus var. scolymus] Length = 183 Score = 72.0 bits (175), Expect = 6e-14 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YKNDRA YE TA+AWT+KYAM Sbjct: 143 SLLTDPNPDDPLVPEIAHMYKNDRAKYEATARAWTQKYAM 182 >BAF19636.2 Os06g0506600, partial [Oryza sativa Japonica Group] Length = 51 Score = 68.6 bits (166), Expect = 6e-14 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YE+TA+ WT+KYAM Sbjct: 11 SLLTDPNPDDPLVPEIAHMYKTDRAKYESTARGWTQKYAM 50 >KRG97124.1 hypothetical protein GLYMA_19G2530001, partial [Glycine max] Length = 82 Score = 69.3 bits (168), Expect = 6e-14 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DR+ YETTA++WT+KYAM Sbjct: 42 SLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAM 81 >KHG30069.1 Ubiquitin-conjugating enzyme E2-17 kDa [Gossypium arboreum] Length = 130 Score = 70.5 bits (171), Expect = 8e-14 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YETTA++WT+KYAM Sbjct: 90 SLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 129 >CAA06493.1 Ubiquitin conjugating enzyme, partial [Cicer arietinum] Length = 61 Score = 68.6 bits (166), Expect = 8e-14 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 230 SLLTDPNTEDPLVPEVAQLYKNDRATYETTAQAWTRKYAM 111 SLLTDPN +DPLVPE+A +YK DRA YE TA++WT+KYAM Sbjct: 21 SLLTDPNPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAM 60