BLASTX nr result
ID: Glycyrrhiza34_contig00028513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028513 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41540.1 Cysteine-rich repeat secretory protein 3 [Glycine soja] 89 4e-19 XP_006589071.1 PREDICTED: cysteine-rich repeat secretory protein... 89 4e-19 XP_003535990.1 PREDICTED: cysteine-rich repeat secretory protein... 89 4e-19 XP_003555737.1 PREDICTED: cysteine-rich repeat secretory protein... 87 1e-18 XP_006605755.1 PREDICTED: cysteine-rich repeat secretory protein... 87 2e-18 ACU19270.1 unknown [Glycine max] 87 2e-18 XP_003590746.1 salt stress response/antifungal domain protein [M... 87 2e-18 XP_016177496.1 PREDICTED: cysteine-rich repeat secretory protein... 86 4e-18 XP_015940915.1 PREDICTED: cysteine-rich repeat secretory protein... 86 4e-18 XP_013467118.1 salt stress response/antifungal domain protein [M... 88 4e-18 GAU23800.1 hypothetical protein TSUD_27090 [Trifolium subterraneum] 86 9e-18 XP_016186549.1 PREDICTED: cysteine-rich repeat secretory protein... 85 1e-17 XP_015949477.1 PREDICTED: cysteine-rich repeat secretory protein... 85 1e-17 KRG92257.1 hypothetical protein GLYMA_20G200200 [Glycine max] 84 1e-17 OIW16924.1 hypothetical protein TanjilG_19229 [Lupinus angustifo... 84 2e-17 XP_017435295.1 PREDICTED: cysteine-rich repeat secretory protein... 84 2e-17 XP_014512728.1 PREDICTED: cysteine-rich repeat secretory protein... 84 2e-17 XP_007144134.1 hypothetical protein PHAVU_007G131500g [Phaseolus... 84 2e-17 XP_014512131.1 PREDICTED: cysteine-rich repeat secretory protein... 84 2e-17 KOM52438.1 hypothetical protein LR48_Vigan09g109700 [Vigna angul... 84 2e-17 >KHN41540.1 Cysteine-rich repeat secretory protein 3 [Glycine soja] Length = 298 Score = 89.0 bits (219), Expect = 4e-19 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE ASSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 19 HVAESASSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 67 >XP_006589071.1 PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X2 [Glycine max] KRH33586.1 hypothetical protein GLYMA_10G133900 [Glycine max] Length = 300 Score = 89.0 bits (219), Expect = 4e-19 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE ASSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 26 HVAESASSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 74 >XP_003535990.1 PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X1 [Glycine max] KRH33587.1 hypothetical protein GLYMA_10G133900 [Glycine max] Length = 305 Score = 89.0 bits (219), Expect = 4e-19 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE ASSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 26 HVAESASSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 74 >XP_003555737.1 PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X2 [Glycine max] KRG90321.1 hypothetical protein GLYMA_20G083000 [Glycine max] Length = 299 Score = 87.4 bits (215), Expect = 1e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE SSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 25 HVAESTSSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 73 >XP_006605755.1 PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X1 [Glycine max] KHN23494.1 Cysteine-rich repeat secretory protein 3 [Glycine soja] KRG90322.1 hypothetical protein GLYMA_20G083000 [Glycine max] Length = 304 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE SSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 25 HVAESTSSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 73 >ACU19270.1 unknown [Glycine max] Length = 304 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE SSDY+TLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTK K Sbjct: 25 HVAESTSSDYSTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKAK 73 >XP_003590746.1 salt stress response/antifungal domain protein [Medicago truncatula] AES60997.1 salt stress response/antifungal domain protein [Medicago truncatula] Length = 333 Score = 87.4 bits (215), Expect = 2e-18 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 1/50 (2%) Frame = -3 Query: 147 HFAEPASS-DYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 HF++ +SS DYTTLVYKGCSKETFTDPNG YSQSLSALFGSLVSQSTKT+ Sbjct: 20 HFSKSSSSPDYTTLVYKGCSKETFTDPNGAYSQSLSALFGSLVSQSTKTR 69 >XP_016177496.1 PREDICTED: cysteine-rich repeat secretory protein 3-like [Arachis ipaensis] Length = 300 Score = 86.3 bits (212), Expect = 4e-18 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H+ ++SDYTTLVYKGCSK+TFTDPNGVYSQ+LS+LFGSLV+QSTKTK Sbjct: 20 HYYSESASDYTTLVYKGCSKDTFTDPNGVYSQALSSLFGSLVAQSTKTK 68 >XP_015940915.1 PREDICTED: cysteine-rich repeat secretory protein 3-like [Arachis duranensis] Length = 302 Score = 86.3 bits (212), Expect = 4e-18 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H+ ++SDYTTLVYKGCSK+TFTDPNGVYSQ+LS+LFGSLV+QSTKTK Sbjct: 20 HYYSESASDYTTLVYKGCSKDTFTDPNGVYSQALSSLFGSLVAQSTKTK 68 >XP_013467118.1 salt stress response/antifungal domain protein [Medicago truncatula] KEH41154.1 salt stress response/antifungal domain protein [Medicago truncatula] Length = 709 Score = 87.8 bits (216), Expect = 4e-18 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 HFAE +SSDYTTLVYKGCSKETF DPNG+YSQ+LS LFGSLVSQSTKTK Sbjct: 24 HFAE-SSSDYTTLVYKGCSKETFIDPNGIYSQTLSTLFGSLVSQSTKTK 71 >GAU23800.1 hypothetical protein TSUD_27090 [Trifolium subterraneum] Length = 307 Score = 85.5 bits (210), Expect = 9e-18 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 5/54 (9%) Frame = -3 Query: 147 HFAEPASS-----DYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 HF+E +SS D TTLVYKGCSKETFTDPNG YSQSLSALFGSLVSQSTKTK Sbjct: 20 HFSESSSSSSSSSDITTLVYKGCSKETFTDPNGAYSQSLSALFGSLVSQSTKTK 73 >XP_016186549.1 PREDICTED: cysteine-rich repeat secretory protein 3-like [Arachis ipaensis] Length = 292 Score = 84.7 bits (208), Expect = 1e-17 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 1/50 (2%) Frame = -3 Query: 147 HFAEPA-SSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 HFA+ A SSDY+T+VYKGCSK+TFTDPNG YSQSLSALFG+LVSQST+TK Sbjct: 24 HFADSAASSDYSTIVYKGCSKDTFTDPNGSYSQSLSALFGTLVSQSTRTK 73 >XP_015949477.1 PREDICTED: cysteine-rich repeat secretory protein 3-like [Arachis duranensis] Length = 292 Score = 84.7 bits (208), Expect = 1e-17 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 1/50 (2%) Frame = -3 Query: 147 HFAEPA-SSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 HFA+ A SSDY+T+VYKGCSK+TFTDPNG YSQSLSALFG+LVSQST+TK Sbjct: 24 HFADSAASSDYSTIVYKGCSKDTFTDPNGSYSQSLSALFGTLVSQSTRTK 73 >KRG92257.1 hypothetical protein GLYMA_20G200200 [Glycine max] Length = 229 Score = 83.6 bits (205), Expect = 1e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 132 ASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 ++SDYTTLVYKGCSKETFTDPNGVYSQ+LS+LFGSLVSQSTK K Sbjct: 23 SASDYTTLVYKGCSKETFTDPNGVYSQALSSLFGSLVSQSTKAK 66 >OIW16924.1 hypothetical protein TanjilG_19229 [Lupinus angustifolius] Length = 269 Score = 84.0 bits (206), Expect = 2e-17 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H E AS DYTTLVYKGCSKETFTDPNG YSQ+LSALFGSLV+QSTKTK Sbjct: 24 HLTESAS-DYTTLVYKGCSKETFTDPNGQYSQALSALFGSLVAQSTKTK 71 >XP_017435295.1 PREDICTED: cysteine-rich repeat secretory protein 3 [Vigna angularis] BAT94688.1 hypothetical protein VIGAN_08131000 [Vigna angularis var. angularis] Length = 296 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 132 ASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 ++SDYTTLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTKTK Sbjct: 23 SASDYTTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKTK 66 >XP_014512728.1 PREDICTED: cysteine-rich repeat secretory protein 3-like [Vigna radiata var. radiata] Length = 296 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 132 ASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 ++SDYTTLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTKTK Sbjct: 23 SASDYTTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKTK 66 >XP_007144134.1 hypothetical protein PHAVU_007G131500g [Phaseolus vulgaris] ESW16128.1 hypothetical protein PHAVU_007G131500g [Phaseolus vulgaris] Length = 296 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 132 ASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 ++SDYTTLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTKTK Sbjct: 23 SASDYTTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKTK 66 >XP_014512131.1 PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X2 [Vigna radiata var. radiata] Length = 297 Score = 84.3 bits (207), Expect = 2e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -3 Query: 147 HFAEPASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 H AE AS DY+TLVYKGCSK++FTDPNGVYSQ+LSALFGSLVSQSTKTK Sbjct: 24 HVAESAS-DYSTLVYKGCSKDSFTDPNGVYSQALSALFGSLVSQSTKTK 71 >KOM52438.1 hypothetical protein LR48_Vigan09g109700 [Vigna angularis] Length = 297 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 132 ASSDYTTLVYKGCSKETFTDPNGVYSQSLSALFGSLVSQSTKTK 1 ++SDYTTLVYKGCSKE FTDPNGVYSQ+LSALFGSLVSQSTKTK Sbjct: 23 SASDYTTLVYKGCSKEPFTDPNGVYSQALSALFGSLVSQSTKTK 66