BLASTX nr result
ID: Glycyrrhiza34_contig00028510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028510 (662 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH00106.1 hypothetical protein GLYMA_18G193500 [Glycine max] 65 2e-10 KJB09775.1 hypothetical protein B456_001G164300 [Gossypium raimo... 59 3e-07 >KRH00106.1 hypothetical protein GLYMA_18G193500 [Glycine max] Length = 68 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 649 FFPSGKNEMHRGPSFCCVAACSSDLRIRRG 560 F PSGKNEMHRGPSFCCV ACSSDLRIRRG Sbjct: 32 FSPSGKNEMHRGPSFCCVGACSSDLRIRRG 61 >KJB09775.1 hypothetical protein B456_001G164300 [Gossypium raimondii] Length = 174 Score = 58.5 bits (140), Expect = 3e-07 Identities = 42/105 (40%), Positives = 43/105 (40%) Frame = -3 Query: 642 LPERMKCIGDHPFVVLRHAPQIYGFAGGLRPYLVD*Q*QRLAKLSRAF*IES*VVYQWCK 463 L ERMKCIGDHPFV Sbjct: 122 LGERMKCIGDHPFV---------------------------------------------- 135 Query: 462 AALCPFSVGERIRP*KVSEQRFFYVGMAFPLDSPNVELSDFVTFA 328 A C + R P QRFFYVGMAFPLD PNVELSDFVTFA Sbjct: 136 -AACSSDLRIRRGP-----QRFFYVGMAFPLDFPNVELSDFVTFA 174