BLASTX nr result
ID: Glycyrrhiza34_contig00028351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028351 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015951992.1 PREDICTED: U-box domain-containing protein 44-lik... 57 2e-07 XP_016186979.1 PREDICTED: U-box domain-containing protein 44-lik... 56 3e-07 KYP68271.1 U-box domain-containing protein 44 [Cajanus cajan] 54 2e-06 XP_014619962.1 PREDICTED: U-box domain-containing protein 44-lik... 54 2e-06 KHN25402.1 U-box domain-containing protein 44 [Glycine soja] 54 2e-06 XP_014619961.1 PREDICTED: U-box domain-containing protein 44-lik... 54 2e-06 XP_014619960.1 PREDICTED: U-box domain-containing protein 44-lik... 54 2e-06 XP_006592096.1 PREDICTED: U-box domain-containing protein 44-lik... 54 2e-06 >XP_015951992.1 PREDICTED: U-box domain-containing protein 44-like [Arachis duranensis] Length = 829 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 123 MNM-MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFA 1 MNM MEKR+F EFMSEL+ L +EV S NPE+E+DAFTEFA Sbjct: 1 MNMIMEKRSFSEFMSELVALVDEVASFAMNPEVEIDAFTEFA 42 >XP_016186979.1 PREDICTED: U-box domain-containing protein 44-like [Arachis ipaensis] Length = 829 Score = 56.2 bits (134), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 123 MNM-MEKRNFYEFMSELIVLGNEVVSCTKNPEIEMDAFTEFA 1 MNM MEKR+F EFMSE++ L +EV S NPE+E+DAFTEFA Sbjct: 1 MNMIMEKRSFSEFMSEIVALVDEVASFAMNPEVEIDAFTEFA 42 >KYP68271.1 U-box domain-containing protein 44 [Cajanus cajan] Length = 771 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM-DAFTEFA 1 M +KR+ YEF+SELIV+ +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKDKRDLYEFVSELIVMADEVASLAKNPEIEIQDAFTEFA 40 >XP_014619962.1 PREDICTED: U-box domain-containing protein 44-like isoform X4 [Glycine max] KRH24418.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24419.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24420.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 829 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFA 1 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFA 41 >KHN25402.1 U-box domain-containing protein 44 [Glycine soja] Length = 829 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFA 1 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFA 41 >XP_014619961.1 PREDICTED: U-box domain-containing protein 44-like isoform X3 [Glycine max] KRH24421.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24422.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 830 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFA 1 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFA 41 >XP_014619960.1 PREDICTED: U-box domain-containing protein 44-like isoform X2 [Glycine max] KRH24423.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24424.1 hypothetical protein GLYMA_12G040400 [Glycine max] KRH24425.1 hypothetical protein GLYMA_12G040400 [Glycine max] Length = 837 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFA 1 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFA 41 >XP_006592096.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592097.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592098.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] XP_006592099.1 PREDICTED: U-box domain-containing protein 44-like isoform X1 [Glycine max] Length = 838 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -2 Query: 117 MMEKRNFYEFMSELIVLGNEVVSCTKNPEIEM--DAFTEFA 1 M EKR+F EF+SELIVL +EV S KNPEIE+ DAFTEFA Sbjct: 1 MKEKRDFSEFVSELIVLADEVASFAKNPEIEIVEDAFTEFA 41