BLASTX nr result
ID: Glycyrrhiza34_contig00028293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028293 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003532807.1 PREDICTED: vegetative incompatibility protein HET... 66 3e-10 XP_004504147.1 PREDICTED: probable U3 small nucleolar RNA-associ... 60 5e-08 XP_006588015.1 PREDICTED: uncharacterized protein LOC102669647 [... 58 7e-08 XP_013446711.1 transducin/WD40 repeat protein [Medicago truncatu... 57 5e-07 >XP_003532807.1 PREDICTED: vegetative incompatibility protein HET-E-1 [Glycine max] KHN29010.1 Myosin heavy chain kinase B [Glycine soja] KRH43090.1 hypothetical protein GLYMA_08G130300 [Glycine max] Length = 431 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +3 Query: 216 MRIQWWLDTSSSANCATATHHSTISLPKLPSHKQQQQHASDSSTS 350 MRIQWWL+T SSANCATATHHSTISLPK Q++HA D S S Sbjct: 1 MRIQWWLNTCSSANCATATHHSTISLPK------QKEHACDDSIS 39 >XP_004504147.1 PREDICTED: probable U3 small nucleolar RNA-associated protein 13 [Cicer arietinum] Length = 441 Score = 59.7 bits (143), Expect = 5e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 216 MRIQWWLDTSSSANCATATHHSTISLPKLPSHKQQQQHASDSSTS 350 MR+Q WLDT SS NCATAT++STISLP L SHK QHAS+ ST+ Sbjct: 1 MRLQSWLDTCSSVNCATATNNSTISLPILRSHK---QHASEYSTT 42 >XP_006588015.1 PREDICTED: uncharacterized protein LOC102669647 [Glycine max] Length = 217 Score = 58.2 bits (139), Expect = 7e-08 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = +3 Query: 216 MRIQWWLDTSSSANCATATHHSTISLPKLPSHKQQQQHASDSS 344 M IQWWL T SSANCAT TH+STISLPK Q+QHA D S Sbjct: 1 MWIQWWLKTCSSANCATVTHYSTISLPK------QKQHACDDS 37 >XP_013446711.1 transducin/WD40 repeat protein [Medicago truncatula] KEH20738.1 transducin/WD40 repeat protein [Medicago truncatula] Length = 447 Score = 56.6 bits (135), Expect = 5e-07 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 216 MRIQWWLDTSSSAN-CATATHHSTISLPKLPSHKQQQQHASDSSTS 350 MR++W LDT SSAN CATATH+STISL PS K QQHASDSSTS Sbjct: 1 MRLRWLLDTCSSANNCATATHNSTISLH--PSKK--QQHASDSSTS 42