BLASTX nr result
ID: Glycyrrhiza34_contig00028092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00028092 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493077.1 PREDICTED: histone-lysine N-methyltransferase, H3... 55 3e-06 >XP_004493077.1 PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 [Cicer arietinum] XP_012569186.1 PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 [Cicer arietinum] Length = 747 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 252 TVDSENAVGALCEKSCAVKVKETIRMFNKHYLHFV 356 TV SENAVGAL +KS KVK+TIR+FNKHYLH + Sbjct: 160 TVGSENAVGALGDKSLTAKVKDTIRVFNKHYLHLI 194