BLASTX nr result
ID: Glycyrrhiza34_contig00027435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00027435 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW19039.1 hypothetical protein TanjilG_10600 [Lupinus angustifo... 115 9e-27 XP_012575506.1 PREDICTED: B3 domain-containing transcription rep... 114 1e-26 XP_012575505.1 PREDICTED: B3 domain-containing transcription rep... 114 1e-26 XP_006576447.1 PREDICTED: B3 domain-containing transcription rep... 111 2e-25 XP_006573404.1 PREDICTED: B3 domain-containing transcription rep... 111 2e-25 XP_006576446.1 PREDICTED: B3 domain-containing transcription rep... 111 2e-25 XP_014630512.1 PREDICTED: B3 domain-containing transcription rep... 111 2e-25 KHN43730.1 B3 domain-containing protein [Glycine soja] 111 2e-25 XP_014490366.1 PREDICTED: B3 domain-containing transcription rep... 106 8e-24 XP_014490364.1 PREDICTED: B3 domain-containing transcription rep... 106 8e-24 XP_007134718.1 hypothetical protein PHAVU_010G070200g [Phaseolus... 106 1e-23 KYP48378.1 B3 domain-containing transcription repressor VAL2 [Ca... 105 2e-23 XP_013455147.1 AP2/B3 transcription factor family protein [Medic... 104 4e-23 XP_013455146.1 AP2/B3 transcription factor family protein [Medic... 104 4e-23 XP_003605289.1 AP2/B3 transcription factor family protein [Medic... 104 4e-23 XP_016184089.1 PREDICTED: B3 domain-containing transcription rep... 104 5e-23 XP_016184086.1 PREDICTED: B3 domain-containing transcription rep... 104 5e-23 XP_019464098.1 PREDICTED: B3 domain-containing transcription rep... 104 5e-23 XP_019446941.1 PREDICTED: B3 domain-containing transcription rep... 103 7e-23 XP_004514737.1 PREDICTED: B3 domain-containing transcription rep... 103 7e-23 >OIW19039.1 hypothetical protein TanjilG_10600 [Lupinus angustifolius] Length = 910 Score = 115 bits (287), Expect = 9e-27 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = +2 Query: 296 VEVVELRLKMESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFH 475 V VELRLKMESR CMNVACA +TSIRWR+GWALRSGEFADLCDKCGSA+EQST+CD+FH Sbjct: 15 VSEVELRLKMESRICMNVACAITTSIRWRRGWALRSGEFADLCDKCGSAYEQSTYCDVFH 74 Query: 476 A 478 + Sbjct: 75 S 75 >XP_012575506.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Cicer arietinum] Length = 925 Score = 114 bits (286), Expect = 1e-26 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 302 VVELRLKMESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 VVEL+LKMES+ CMN+ CATSTSIRWRKGW LRSGEFADLCDKCG+A+EQS FCDMFHA Sbjct: 52 VVELKLKMESKCCMNMTCATSTSIRWRKGWLLRSGEFADLCDKCGAAYEQSAFCDMFHA 110 >XP_012575505.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Cicer arietinum] Length = 961 Score = 114 bits (286), Expect = 1e-26 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 302 VVELRLKMESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 VVEL+LKMES+ CMN+ CATSTSIRWRKGW LRSGEFADLCDKCG+A+EQS FCDMFHA Sbjct: 52 VVELKLKMESKCCMNMTCATSTSIRWRKGWLLRSGEFADLCDKCGAAYEQSAFCDMFHA 110 >XP_006576447.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Glycine max] KRH65427.1 hypothetical protein GLYMA_03G035200 [Glycine max] Length = 869 Score = 111 bits (277), Expect = 2e-25 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACATST+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATSTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >XP_006573404.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Glycine max] KRH76124.1 hypothetical protein GLYMA_01G133000 [Glycine max] Length = 872 Score = 111 bits (277), Expect = 2e-25 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACATST+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATSTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >XP_006576446.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Glycine max] KRH65426.1 hypothetical protein GLYMA_03G035200 [Glycine max] Length = 905 Score = 111 bits (277), Expect = 2e-25 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACATST+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATSTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >XP_014630512.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Glycine max] KRH76125.1 hypothetical protein GLYMA_01G133000 [Glycine max] Length = 908 Score = 111 bits (277), Expect = 2e-25 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACATST+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATSTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >KHN43730.1 B3 domain-containing protein [Glycine soja] Length = 909 Score = 111 bits (277), Expect = 2e-25 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACATST+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATSTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >XP_014490366.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Vigna radiata var. radiata] Length = 872 Score = 106 bits (265), Expect = 8e-24 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACAT T+IRWRKGWALRSGEFADLCDKCGSA+EQST+CD FH+ Sbjct: 1 MESRSCMNVACATLTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDTFHS 52 >XP_014490364.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Vigna radiata var. radiata] XP_014490365.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Vigna radiata var. radiata] Length = 908 Score = 106 bits (265), Expect = 8e-24 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACAT T+IRWRKGWALRSGEFADLCDKCGSA+EQST+CD FH+ Sbjct: 1 MESRSCMNVACATLTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDTFHS 52 >XP_007134718.1 hypothetical protein PHAVU_010G070200g [Phaseolus vulgaris] XP_007134719.1 hypothetical protein PHAVU_010G070200g [Phaseolus vulgaris] ESW06712.1 hypothetical protein PHAVU_010G070200g [Phaseolus vulgaris] ESW06713.1 hypothetical protein PHAVU_010G070200g [Phaseolus vulgaris] Length = 906 Score = 106 bits (264), Expect = 1e-23 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFH 475 MES++CMNVACAT T+IRWRKGWALRSGEFADLCDKCGSA+EQST+CDMFH Sbjct: 1 MESKNCMNVACATLTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFH 51 >KYP48378.1 B3 domain-containing transcription repressor VAL2 [Cajanus cajan] Length = 801 Score = 105 bits (262), Expect = 2e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVACAT T+ RWRKGW LRSGEFADLCDKCGSA+EQST+CDMFH+ Sbjct: 1 MESRSCMNVACATLTTTRWRKGWTLRSGEFADLCDKCGSAYEQSTYCDMFHS 52 >XP_013455147.1 AP2/B3 transcription factor family protein [Medicago truncatula] KEH29194.1 AP2/B3 transcription factor family protein [Medicago truncatula] Length = 649 Score = 104 bits (260), Expect = 4e-23 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MES+ CMNV C TSTSIRWRKGW LRSGEFADLCDKCGSA+EQS FCDMFHA Sbjct: 1 MESKCCMNVVCGTSTSIRWRKGWILRSGEFADLCDKCGSAYEQSAFCDMFHA 52 >XP_013455146.1 AP2/B3 transcription factor family protein [Medicago truncatula] KEH29193.1 AP2/B3 transcription factor family protein [Medicago truncatula] Length = 864 Score = 104 bits (260), Expect = 4e-23 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MES+ CMNV C TSTSIRWRKGW LRSGEFADLCDKCGSA+EQS FCDMFHA Sbjct: 1 MESKCCMNVVCGTSTSIRWRKGWILRSGEFADLCDKCGSAYEQSAFCDMFHA 52 >XP_003605289.1 AP2/B3 transcription factor family protein [Medicago truncatula] AES87486.1 AP2/B3 transcription factor family protein [Medicago truncatula] Length = 900 Score = 104 bits (260), Expect = 4e-23 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MES+ CMNV C TSTSIRWRKGW LRSGEFADLCDKCGSA+EQS FCDMFHA Sbjct: 1 MESKCCMNVVCGTSTSIRWRKGWILRSGEFADLCDKCGSAYEQSAFCDMFHA 52 >XP_016184089.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Arachis ipaensis] Length = 870 Score = 104 bits (259), Expect = 5e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNV CAT TSI+WRKGWALRSGEFADLCDKCGSA+EQSTFC+ FH+ Sbjct: 1 MESRSCMNVVCATLTSIQWRKGWALRSGEFADLCDKCGSAYEQSTFCEKFHS 52 >XP_016184086.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Arachis ipaensis] XP_016184087.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Arachis ipaensis] XP_016184088.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X1 [Arachis ipaensis] Length = 906 Score = 104 bits (259), Expect = 5e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNV CAT TSI+WRKGWALRSGEFADLCDKCGSA+EQSTFC+ FH+ Sbjct: 1 MESRSCMNVVCATLTSIQWRKGWALRSGEFADLCDKCGSAYEQSTFCEKFHS 52 >XP_019464098.1 PREDICTED: B3 domain-containing transcription repressor VAL2 [Lupinus angustifolius] OIW00906.1 hypothetical protein TanjilG_19847 [Lupinus angustifolius] Length = 907 Score = 104 bits (259), Expect = 5e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESRSCMNVAC+T TSI WRKGWALRSGE ADLCDKCGSA+EQSTFCD+FH+ Sbjct: 1 MESRSCMNVACSTRTSILWRKGWALRSGELADLCDKCGSAYEQSTFCDLFHS 52 >XP_019446941.1 PREDICTED: B3 domain-containing transcription repressor VAL2-like [Lupinus angustifolius] Length = 887 Score = 103 bits (258), Expect = 7e-23 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MESR CMNVACA +TSIRWR+GWALRSGEFADLCDKCGSA+EQST+CD+FH+ Sbjct: 1 MESRICMNVACAITTSIRWRRGWALRSGEFADLCDKCGSAYEQSTYCDVFHS 52 >XP_004514737.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X3 [Cicer arietinum] XP_004514738.1 PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X3 [Cicer arietinum] Length = 903 Score = 103 bits (258), Expect = 7e-23 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +2 Query: 323 MESRSCMNVACATSTSIRWRKGWALRSGEFADLCDKCGSAFEQSTFCDMFHA 478 MES+ CMN+ CATSTSIRWRKGW LRSGEFADLCDKCG+A+EQS FCDMFHA Sbjct: 1 MESKCCMNMTCATSTSIRWRKGWLLRSGEFADLCDKCGAAYEQSAFCDMFHA 52