BLASTX nr result
ID: Glycyrrhiza34_contig00026840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026840 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004511291.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 6e-18 XP_003598903.2 PPR containing plant-like protein [Medicago trunc... 87 9e-18 XP_004515007.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-17 XP_012569772.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 8e-17 XP_007149018.1 hypothetical protein PHAVU_005G033500g [Phaseolus... 80 2e-15 XP_014498722.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-15 BAT93460.1 hypothetical protein VIGAN_07242700 [Vigna angularis ... 79 6e-15 XP_017425383.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 6e-15 KYP41047.1 Pentatricopeptide repeat-containing protein At4g20740... 78 2e-14 GAU10008.1 hypothetical protein TSUD_120070 [Trifolium subterran... 77 2e-14 XP_015881935.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 5e-14 XP_019432613.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 7e-14 XP_010670382.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 7e-14 KDO83244.1 hypothetical protein CISIN_1g006744mg [Citrus sinensis] 74 2e-13 KMT17191.1 hypothetical protein BVRB_2g040990 [Beta vulgaris sub... 74 3e-13 XP_010645700.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-13 XP_006482966.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 9e-13 XP_006438906.1 hypothetical protein CICLE_v10030824mg [Citrus cl... 73 9e-13 XP_014632180.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 9e-13 XP_018810533.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 1e-12 >XP_004511291.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_004511445.2 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574365.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574366.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574367.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574368.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 87.4 bits (215), Expect = 6e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPPQTPT PNKFYF+YGHRKPSQNRPTVRGGLFSNRQTLT Sbjct: 1 MPPQTPTTPNKFYFYYGHRKPSQNRPTVRGGLFSNRQTLT 40 >XP_003598903.2 PPR containing plant-like protein [Medicago truncatula] AES69154.2 PPR containing plant-like protein [Medicago truncatula] Length = 723 Score = 87.0 bits (214), Expect = 9e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPPQTPT PNKFYFFYGHRKPSQNRPTVRGGLFSNR+TLT Sbjct: 1 MPPQTPTPPNKFYFFYGHRKPSQNRPTVRGGLFSNRKTLT 40 >XP_004515007.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 85.9 bits (211), Expect = 2e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPPQTPT PNKFYF+YGHR+PSQNRPTVRGGLFSNRQTLT Sbjct: 1 MPPQTPTTPNKFYFYYGHRQPSQNRPTVRGGLFSNRQTLT 40 >XP_012569772.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569773.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569774.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569775.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569776.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 84.3 bits (207), Expect = 8e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 M PQTPT PNKFYF+YGHRKPSQNRPTVRGGLFSNRQTLT Sbjct: 1 MSPQTPTTPNKFYFYYGHRKPSQNRPTVRGGLFSNRQTLT 40 >XP_007149018.1 hypothetical protein PHAVU_005G033500g [Phaseolus vulgaris] ESW21012.1 hypothetical protein PHAVU_005G033500g [Phaseolus vulgaris] Length = 715 Score = 80.1 bits (196), Expect = 2e-15 Identities = 37/42 (88%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -2 Query: 120 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPPQ P KPN FYFFYGHRKPSQNRPTVRGGLFSNRQTLT Sbjct: 1 MPPQVPQPNKPNNFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 42 >XP_014498722.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vigna radiata var. radiata] Length = 716 Score = 79.3 bits (194), Expect = 4e-15 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = -2 Query: 120 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQT+ Sbjct: 1 MPPQVPQPNKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTI 41 >BAT93460.1 hypothetical protein VIGAN_07242700 [Vigna angularis var. angularis] Length = 716 Score = 79.0 bits (193), Expect = 6e-15 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = -2 Query: 120 MPPQTPT--KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQT+ Sbjct: 1 MPPQVPQPIKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTI 41 >XP_017425383.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vigna angularis] KOM42525.1 hypothetical protein LR48_Vigan05g012900 [Vigna angularis] Length = 716 Score = 79.0 bits (193), Expect = 6e-15 Identities = 36/41 (87%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = -2 Query: 120 MPPQTPT--KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQT+ Sbjct: 1 MPPQVPQPIKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTI 41 >KYP41047.1 Pentatricopeptide repeat-containing protein At4g20740 family [Cajanus cajan] Length = 679 Score = 77.8 bits (190), Expect = 2e-14 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -2 Query: 120 MPPQTPT-KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P PNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL Sbjct: 1 MPPQPPQPNPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 40 >GAU10008.1 hypothetical protein TSUD_120070 [Trifolium subterraneum] Length = 626 Score = 77.4 bits (189), Expect = 2e-14 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPP P PNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT Sbjct: 1 MPP--PQTPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 38 >XP_015881935.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 isoform X1 [Ziziphus jujuba] XP_015881937.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 isoform X2 [Ziziphus jujuba] Length = 714 Score = 76.3 bits (186), Expect = 5e-14 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -2 Query: 120 MPPQTP-TKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ+P TKP KFYFFYGHRKPSQNRPTVRGGLFSNR +L Sbjct: 1 MPPQSPPTKPQKFYFFYGHRKPSQNRPTVRGGLFSNRLSL 40 >XP_019432613.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Lupinus angustifolius] OIW21254.1 hypothetical protein TanjilG_31184 [Lupinus angustifolius] Length = 725 Score = 75.9 bits (185), Expect = 7e-14 Identities = 35/40 (87%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = -2 Query: 117 PPQ--TPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 PPQ TPTK NK+YFFYGHR PSQNRPTVRGGLFSNRQTL Sbjct: 3 PPQAPTPTKANKYYFFYGHRNPSQNRPTVRGGLFSNRQTL 42 >XP_010670382.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Beta vulgaris subsp. vulgaris] Length = 741 Score = 75.9 bits (185), Expect = 7e-14 Identities = 36/42 (85%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -2 Query: 123 KMPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 KMPPQ P KPNKFYFFYG RKPSQNRPTV GGLFSNRQTL Sbjct: 2 KMPPQPPPPAKPNKFYFFYGKRKPSQNRPTVSGGLFSNRQTL 43 >KDO83244.1 hypothetical protein CISIN_1g006744mg [Citrus sinensis] Length = 632 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQTP +P K YFFYGHRKPSQNRPTV GGLFSNRQ+L Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGLFSNRQSL 39 >KMT17191.1 hypothetical protein BVRB_2g040990 [Beta vulgaris subsp. vulgaris] Length = 739 Score = 73.9 bits (180), Expect = 3e-13 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -2 Query: 120 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P KPNKFYFFYG RKPSQNRPTV GGLFSNRQTL Sbjct: 1 MPPQPPPPAKPNKFYFFYGKRKPSQNRPTVSGGLFSNRQTL 41 >XP_010645700.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] XP_019073365.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] XP_019073366.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] CBI17752.3 unnamed protein product, partial [Vitis vinifera] Length = 729 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -2 Query: 120 MPPQT-PTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQ P KP+KFYFFYGHRKPSQNRPTV GGLFSNR TL Sbjct: 1 MPPQPQPPKPHKFYFFYGHRKPSQNRPTVHGGLFSNRTTL 40 >XP_006482966.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Citrus sinensis] Length = 721 Score = 72.8 bits (177), Expect = 9e-13 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQTP +P K YFFYGHRKPSQNRPTV GG FSNRQ+L Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGFFSNRQSL 39 >XP_006438906.1 hypothetical protein CICLE_v10030824mg [Citrus clementina] ESR52146.1 hypothetical protein CICLE_v10030824mg [Citrus clementina] Length = 721 Score = 72.8 bits (177), Expect = 9e-13 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 120 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 MPPQTP +P K YFFYGHRKPSQNRPTV GG FSNRQ+L Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGFFSNRQSL 39 >XP_014632180.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Glycine max] KRH55198.1 hypothetical protein GLYMA_06G236700 [Glycine max] Length = 764 Score = 72.8 bits (177), Expect = 9e-13 Identities = 38/55 (69%), Positives = 38/55 (69%), Gaps = 15/55 (27%) Frame = -2 Query: 123 KMPPQTP--TKP-------------NKFYFFYGHRKPSQNRPTVRGGLFSNRQTL 4 KMPPQ P TKP NKFYFFYGHR PSQNRPTVRGGLFSNRQTL Sbjct: 31 KMPPQVPKPTKPRNCGPPFTIPKPTNKFYFFYGHRNPSQNRPTVRGGLFSNRQTL 85 >XP_018810533.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] XP_018810534.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] XP_018810535.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] Length = 726 Score = 72.4 bits (176), Expect = 1e-12 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 120 MPPQTPT-KPNKFYFFYGHRKPSQNRPTVRGGLFSNRQTLT 1 MPPQ+P KP+ +YFFYGHRKPSQNRP VRGGLFSNRQ+L+ Sbjct: 1 MPPQSPPPKPHNYYFFYGHRKPSQNRPVVRGGLFSNRQSLS 41