BLASTX nr result
ID: Glycyrrhiza34_contig00026600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026600 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004486474.1 PREDICTED: pentatricopeptide repeat-containing pr... 162 1e-44 GAU12504.1 hypothetical protein TSUD_377550 [Trifolium subterran... 151 2e-40 XP_019425542.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 2e-40 KOM53147.1 hypothetical protein LR48_Vigan09g180600 [Vigna angul... 139 1e-38 XP_016197746.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_015959359.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 3e-38 XP_006597666.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_007147463.1 hypothetical protein PHAVU_006G126800g [Phaseolus... 142 4e-37 XP_003594555.1 PPR containing plant-like protein [Medicago trunc... 140 1e-36 XP_017433996.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 4e-36 XP_015572797.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 138 7e-36 XP_009344487.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_014517084.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 1e-35 KDO51842.1 hypothetical protein CISIN_1g0413311mg, partial [Citr... 130 2e-35 XP_008228402.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 4e-35 XP_008380840.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 5e-35 XP_018843284.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 7e-35 CDY45642.1 BnaA05g15090D [Brassica napus] 135 9e-35 XP_009144868.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 1e-34 OAY36582.1 hypothetical protein MANES_11G031900 [Manihot esculenta] 129 1e-34 >XP_004486474.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Cicer arietinum] Length = 664 Score = 162 bits (411), Expect = 1e-44 Identities = 79/96 (82%), Positives = 84/96 (87%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFLEDLDRCIGLVKKWDLTLNAYTYKCFLQAY 111 R + A SL+DDM+RR +RGSISTVNIL+GF DLDRCIGLVKKWDLTLNAYTYKC LQAY Sbjct: 165 RFEQASSLIDDMERRGVRGSISTVNILIGFFRDLDRCIGLVKKWDLTLNAYTYKCLLQAY 224 Query: 110 LRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LRSHDS KAF VYLDM RRGY LDIF YNMLLDALA Sbjct: 225 LRSHDSSKAFDVYLDMLRRGYHLDIFGYNMLLDALA 260 >GAU12504.1 hypothetical protein TSUD_377550 [Trifolium subterraneum] Length = 647 Score = 151 bits (381), Expect = 2e-40 Identities = 74/96 (77%), Positives = 81/96 (84%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFLEDLDRCIGLVKKWDLTLNAYTYKCFLQAY 111 R + A SLLDDM+RR +RGSISTVNIL+GF DLDRC+GLVKKW+L LNAYTYKC LQAY Sbjct: 148 RFEQAESLLDDMERRGVRGSISTVNILIGFFGDLDRCVGLVKKWELRLNAYTYKCLLQAY 207 Query: 110 LRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LR D +KAF VYLDM RRGY LDIF YNMLLDALA Sbjct: 208 LRLRDCNKAFDVYLDMLRRGYHLDIFGYNMLLDALA 243 >XP_019425542.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Lupinus angustifolius] OIV91809.1 hypothetical protein TanjilG_14388 [Lupinus angustifolius] Length = 644 Score = 150 bits (380), Expect = 2e-40 Identities = 73/99 (73%), Positives = 83/99 (83%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R HA SLL+DMD R +RGSISTVNIL+GF EDLDRC+GLVKKWDL NAYTYKC L Sbjct: 141 RFDHARSLLNDMDHRSIRGSISTVNILIGFFGMGEDLDRCVGLVKKWDLRFNAYTYKCLL 200 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLRS+DS+KAF VY +M ++GYKLDIF YNMLLD+LA Sbjct: 201 QAYLRSYDSEKAFDVYFEMLQKGYKLDIFGYNMLLDSLA 239 >KOM53147.1 hypothetical protein LR48_Vigan09g180600 [Vigna angularis] Length = 259 Score = 139 bits (350), Expect = 1e-38 Identities = 72/99 (72%), Positives = 75/99 (75%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R A LL M R +RGSISTVNILVGF EDL+RC+ LVKKWDL LNAYTYKC L Sbjct: 143 RFDQARDLLSHMHRHAVRGSISTVNILVGFFGSGEDLERCVALVKKWDLRLNAYTYKCLL 202 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLRS DS AF VY DM RRGYKLDIF YNMLLDALA Sbjct: 203 QAYLRSRDSSTAFQVYRDMIRRGYKLDIFGYNMLLDALA 241 >XP_016197746.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Arachis ipaensis] Length = 501 Score = 144 bits (362), Expect = 2e-38 Identities = 72/95 (75%), Positives = 78/95 (82%), Gaps = 3/95 (3%) Frame = -3 Query: 278 ALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFLQAYL 108 A LL DMDR +RGSISTVNIL+GF +DL+ C+GLVKKWDL LNAYTYKC LQAYL Sbjct: 2 ARDLLRDMDRLGIRGSISTVNILIGFFGTGQDLEMCVGLVKKWDLRLNAYTYKCLLQAYL 61 Query: 107 RSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 RS DS K F VYL+MQRRGYKLDIF YNMLLDALA Sbjct: 62 RSRDSSKGFDVYLEMQRRGYKLDIFGYNMLLDALA 96 >XP_015959359.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Arachis duranensis] Length = 667 Score = 145 bits (365), Expect = 3e-38 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 +R A LL DMDR +RGSISTVNIL+GF +DL+ C+GLVKKWDL LNAYTYKC Sbjct: 163 ERFDMARDLLRDMDRLGIRGSISTVNILIGFFGTGQDLEMCVGLVKKWDLRLNAYTYKCL 222 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LQAYLRS DS K F VYL+MQRRGYKLDIF YNMLLDALA Sbjct: 223 LQAYLRSRDSSKGFDVYLEMQRRGYKLDIFGYNMLLDALA 262 >XP_006597666.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Glycine max] KRH11807.1 hypothetical protein GLYMA_15G131800 [Glycine max] Length = 648 Score = 144 bits (364), Expect = 4e-38 Identities = 74/99 (74%), Positives = 79/99 (79%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R A SLL DMDRR +RGSISTVNILVGF EDL+RC+ LVKKWDL LNAYTYKC L Sbjct: 145 RFDQARSLLHDMDRRAVRGSISTVNILVGFFGAGEDLERCVSLVKKWDLRLNAYTYKCLL 204 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLR+ DS AF VYLDM R GY+LDIF YNMLLDALA Sbjct: 205 QAYLRALDSSTAFRVYLDMIRHGYRLDIFGYNMLLDALA 243 >XP_007147463.1 hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] ESW19457.1 hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] Length = 646 Score = 142 bits (357), Expect = 4e-37 Identities = 73/99 (73%), Positives = 76/99 (76%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R A LL M R +RGSISTVNILVGF EDL+RC+ LVKKWDL LNAYTYKC L Sbjct: 143 RFDQARDLLSHMHRHAVRGSISTVNILVGFFGSGEDLERCVALVKKWDLRLNAYTYKCLL 202 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLRS DS AF VYLDM RRGYKLDIF YNMLLDALA Sbjct: 203 QAYLRSRDSSTAFQVYLDMVRRGYKLDIFGYNMLLDALA 241 >XP_003594555.1 PPR containing plant-like protein [Medicago truncatula] AES64806.1 PPR containing plant-like protein [Medicago truncatula] Length = 639 Score = 140 bits (353), Expect = 1e-36 Identities = 68/96 (70%), Positives = 77/96 (80%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFLEDLDRCIGLVKKWDLTLNAYTYKCFLQAY 111 R + SLLDDM++R ++GSISTVNIL+GF DLDRC+GLVKKW L NAY+YKC LQ Y Sbjct: 139 RFEQTESLLDDMEKRGVKGSISTVNILIGFFGDLDRCVGLVKKWGLRFNAYSYKCLLQGY 198 Query: 110 LRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LR D DKAF VYLDM R GY LDIFA+NMLLDALA Sbjct: 199 LRLRDCDKAFGVYLDMLRCGYSLDIFAFNMLLDALA 234 >XP_017433996.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna angularis] BAT87695.1 hypothetical protein VIGAN_05108900 [Vigna angularis var. angularis] Length = 646 Score = 139 bits (350), Expect = 4e-36 Identities = 72/99 (72%), Positives = 75/99 (75%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R A LL M R +RGSISTVNILVGF EDL+RC+ LVKKWDL LNAYTYKC L Sbjct: 143 RFDQARDLLSHMHRHAVRGSISTVNILVGFFGSGEDLERCVALVKKWDLRLNAYTYKCLL 202 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLRS DS AF VY DM RRGYKLDIF YNMLLDALA Sbjct: 203 QAYLRSRDSSTAFQVYRDMIRRGYKLDIFGYNMLLDALA 241 >XP_015572797.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g51965, mitochondrial, partial [Ricinus communis] Length = 602 Score = 138 bits (347), Expect = 7e-36 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR SLL DMD+ +RG+ISTVNIL+GF EDL+RCIGL++KWDL +N YTYKC Sbjct: 98 DRFNLVRSLLSDMDKNGVRGTISTVNILIGFFGDGEDLERCIGLIEKWDLKMNGYTYKCL 157 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 +QAYLRS DSD F VYL+M+R+GY LDIFA+NMLLDALA Sbjct: 158 VQAYLRSCDSDNGFRVYLEMKRKGYTLDIFAFNMLLDALA 197 >XP_009344487.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Pyrus x bretschneideri] Length = 660 Score = 138 bits (347), Expect = 1e-35 Identities = 67/93 (72%), Positives = 78/93 (83%), Gaps = 3/93 (3%) Frame = -3 Query: 272 SLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFLQAYLRS 102 S+L DMDR +RG+ISTVNILVG EDL+ CIGLVKKW+L +N+YTYKC LQA+LRS Sbjct: 163 SILRDMDRSSIRGNISTVNILVGLFGSTEDLETCIGLVKKWNLNMNSYTYKCLLQAFLRS 222 Query: 101 HDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 DS KAF Y+DM+RRGYKLDIFAYNML+DALA Sbjct: 223 RDSGKAFDTYIDMRRRGYKLDIFAYNMLMDALA 255 >XP_014517084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna radiata var. radiata] Length = 646 Score = 137 bits (346), Expect = 1e-35 Identities = 71/99 (71%), Positives = 74/99 (74%), Gaps = 3/99 (3%) Frame = -3 Query: 290 RSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFL 120 R A LL M R +RGSISTVNILVGF EDL+RC+ LVKKWDL LNAYTYKC L Sbjct: 143 RFDQARDLLSQMHRNAVRGSISTVNILVGFFGSGEDLERCVALVKKWDLRLNAYTYKCLL 202 Query: 119 QAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 QAYLRS DS AF VY DM RGYKLDIF YNMLLDALA Sbjct: 203 QAYLRSRDSSTAFQVYRDMVTRGYKLDIFGYNMLLDALA 241 >KDO51842.1 hypothetical protein CISIN_1g0413311mg, partial [Citrus sinensis] Length = 247 Score = 130 bits (328), Expect = 2e-35 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR +LLDDM+R RG+ISTVNIL+GF DL RCIGLVKKWDL +N YTYKC Sbjct: 144 DRFDLVGTLLDDMERSMTRGTISTVNILIGFFGCSNDLKRCIGLVKKWDLKMNCYTYKCL 203 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LQA+LRS D +AF VY +M+ +GYKLDIF YNMLLDALA Sbjct: 204 LQAHLRSRDVHEAFRVYGEMRAKGYKLDIFGYNMLLDALA 243 >XP_008228402.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Prunus mume] Length = 661 Score = 136 bits (343), Expect = 4e-35 Identities = 68/95 (71%), Positives = 76/95 (80%), Gaps = 3/95 (3%) Frame = -3 Query: 278 ALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFLQAYL 108 A S+L DMDR +RG+ISTVNIL+G EDL CIGLVKKW L +N YTYKC LQA+L Sbjct: 162 ARSILRDMDRSNIRGNISTVNILIGLFGDTEDLQTCIGLVKKWCLNMNCYTYKCLLQAFL 221 Query: 107 RSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 RSHDS KAF YL+M+RRGYKLDIF YNMLLDALA Sbjct: 222 RSHDSTKAFDTYLEMRRRGYKLDIFGYNMLLDALA 256 >XP_008380840.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Malus domestica] Length = 660 Score = 136 bits (342), Expect = 5e-35 Identities = 66/93 (70%), Positives = 77/93 (82%), Gaps = 3/93 (3%) Frame = -3 Query: 272 SLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCFLQAYLRS 102 S+L DMDR + G+ISTVNIL+G EDL+ CIGLVKKW+L +N+YTYKC LQA+LRS Sbjct: 163 SILRDMDRSSISGNISTVNILIGLFGSTEDLETCIGLVKKWNLNMNSYTYKCLLQAFLRS 222 Query: 101 HDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 DS KAF Y+DM+RRGYKLDIFAYNMLLDALA Sbjct: 223 RDSGKAFDTYIDMRRRGYKLDIFAYNMLLDALA 255 >XP_018843284.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Juglans regia] Length = 658 Score = 135 bits (341), Expect = 7e-35 Identities = 70/100 (70%), Positives = 77/100 (77%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR S+L MD RG+ISTVNIL+GF EDLD C L+KKW+LT+NAYTYKC Sbjct: 154 DRFDLVRSVLSQMDLSNARGTISTVNILIGFFGNSEDLDLCTSLIKKWNLTMNAYTYKCL 213 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LQAYLRS D DKAF VY DM+RRGYKLDIFAYNMLLDALA Sbjct: 214 LQAYLRSLDFDKAFDVYNDMRRRGYKLDIFAYNMLLDALA 253 >CDY45642.1 BnaA05g15090D [Brassica napus] Length = 653 Score = 135 bits (340), Expect = 9e-35 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR S+LD M + +RG+ISTVNIL+GFL EDL+ C+GLVKKW+L +N++TYKC Sbjct: 150 DRFDRVRSILDQMVKSNVRGNISTVNILIGFLGNTEDLEMCLGLVKKWELKMNSFTYKCL 209 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LQAYLRS DS KAFHVY +++R G+KLD+FAYNMLLDALA Sbjct: 210 LQAYLRSRDSSKAFHVYCEIRRGGHKLDVFAYNMLLDALA 249 >XP_009144868.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Brassica rapa] Length = 684 Score = 135 bits (340), Expect = 1e-34 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR S+LD M + +RG+ISTVNIL+GFL EDL+ C+GLVKKW+L +N++TYKC Sbjct: 181 DRFDRVRSILDQMVKSNVRGNISTVNILIGFLGNTEDLEMCLGLVKKWELKMNSFTYKCL 240 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 LQAYLRS DS KAFHVY +++R G+KLD+FAYNMLLDALA Sbjct: 241 LQAYLRSRDSSKAFHVYCEIRRGGHKLDVFAYNMLLDALA 280 >OAY36582.1 hypothetical protein MANES_11G031900 [Manihot esculenta] Length = 277 Score = 129 bits (324), Expect = 1e-34 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 3/100 (3%) Frame = -3 Query: 293 DRSQHALSLLDDMDRRCLRGSISTVNILVGFL---EDLDRCIGLVKKWDLTLNAYTYKCF 123 DR +++ +M++ +RG+ISTVNIL+GF EDLD+ + L++KW L +N YTYKC Sbjct: 160 DRVNLVRAVVSEMEKHGVRGTISTVNILIGFFGDTEDLDKSVALIEKWGLRMNGYTYKCL 219 Query: 122 LQAYLRSHDSDKAFHVYLDMQRRGYKLDIFAYNMLLDALA 3 +QAYLRSH+S+K F VYL+M+R+GYKLDIFAYNMLLDALA Sbjct: 220 VQAYLRSHNSEKGFRVYLEMKRKGYKLDIFAYNMLLDALA 259