BLASTX nr result
ID: Glycyrrhiza34_contig00026580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026580 (449 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN35461.1 Putative ribonuclease H protein, partial [Glycine soja] 51 6e-06 >KHN35461.1 Putative ribonuclease H protein, partial [Glycine soja] Length = 72 Score = 51.2 bits (121), Expect = 6e-06 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +3 Query: 132 FHVYGDLLHDNSNLARRQWHLKFQHVMREANRCADFFAKAAYQVQA 269 +H Y L+H N RQW+L FQH+ RE N+C DF A + QA Sbjct: 1 YHPYTSLIHRIINFKTRQWNLTFQHIYREGNQCPDFLANQGFSSQA 46