BLASTX nr result
ID: Glycyrrhiza34_contig00026564
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026564 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM25523.1 hypothetical protein LR48_Vigan107s004200 [Vigna angu... 76 4e-16 XP_014634265.1 PREDICTED: uncharacterized protein At2g02148-like... 77 2e-14 XP_016191260.1 PREDICTED: uncharacterized protein At2g02148 isof... 77 2e-14 KHN28907.1 Hypothetical protein glysoja_025701 [Glycine soja] 77 2e-14 XP_016191256.1 PREDICTED: uncharacterized protein At2g02148 isof... 77 3e-14 XP_015957945.1 PREDICTED: uncharacterized protein At2g02148 [Ara... 77 3e-14 KHN25948.1 Hypothetical protein glysoja_018802 [Glycine soja] 77 3e-14 XP_003524832.1 PREDICTED: uncharacterized protein At2g02148-like... 77 3e-14 XP_007158844.1 hypothetical protein PHAVU_002G186800g [Phaseolus... 77 3e-14 KYP61291.1 Uncharacterized protein At2g02148 family [Cajanus cajan] 77 3e-14 XP_004504627.1 PREDICTED: uncharacterized protein At2g02148 [Cic... 76 5e-14 XP_017405639.1 PREDICTED: uncharacterized protein At2g02148 [Vig... 76 5e-14 XP_014509879.1 PREDICTED: uncharacterized protein At2g02148 isof... 76 5e-14 OAY83831.1 Uncharacterized protein ACMD2_06292 [Ananas comosus] 73 7e-14 GAU13766.1 hypothetical protein TSUD_82750 [Trifolium subterraneum] 70 1e-13 XP_014509882.1 PREDICTED: uncharacterized protein At2g02148 isof... 75 1e-13 XP_007158846.1 hypothetical protein PHAVU_002G186800g [Phaseolus... 75 1e-13 EYU30226.1 hypothetical protein MIMGU_mgv1a0120852mg, partial [E... 72 2e-13 OAY39100.1 hypothetical protein MANES_10G067600 [Manihot esculenta] 72 2e-13 XP_010043890.1 PREDICTED: uncharacterized protein At2g02148 [Euc... 74 4e-13 >KOM25523.1 hypothetical protein LR48_Vigan107s004200 [Vigna angularis] Length = 89 Score = 76.3 bits (186), Expect = 4e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 ++P TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 55 MMPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 89 >XP_014634265.1 PREDICTED: uncharacterized protein At2g02148-like [Glycine max] XP_014634266.1 PREDICTED: uncharacterized protein At2g02148-like [Glycine max] KRH42450.1 hypothetical protein GLYMA_08G090600 [Glycine max] KRH42451.1 hypothetical protein GLYMA_08G090600 [Glycine max] Length = 366 Score = 77.0 bits (188), Expect = 2e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 332 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 366 >XP_016191260.1 PREDICTED: uncharacterized protein At2g02148 isoform X2 [Arachis ipaensis] Length = 373 Score = 77.0 bits (188), Expect = 2e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 +LPPTPAK+CDECGAPYLRETSKFCSECGSKRLG Sbjct: 339 MLPPTPAKYCDECGAPYLRETSKFCSECGSKRLG 372 >KHN28907.1 Hypothetical protein glysoja_025701 [Glycine soja] Length = 431 Score = 77.0 bits (188), Expect = 2e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 397 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 431 >XP_016191256.1 PREDICTED: uncharacterized protein At2g02148 isoform X1 [Arachis ipaensis] XP_016191257.1 PREDICTED: uncharacterized protein At2g02148 isoform X1 [Arachis ipaensis] XP_016191259.1 PREDICTED: uncharacterized protein At2g02148 isoform X1 [Arachis ipaensis] Length = 433 Score = 77.0 bits (188), Expect = 3e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 +LPPTPAK+CDECGAPYLRETSKFCSECGSKRLG Sbjct: 399 MLPPTPAKYCDECGAPYLRETSKFCSECGSKRLG 432 >XP_015957945.1 PREDICTED: uncharacterized protein At2g02148 [Arachis duranensis] XP_015957946.1 PREDICTED: uncharacterized protein At2g02148 [Arachis duranensis] XP_015957947.1 PREDICTED: uncharacterized protein At2g02148 [Arachis duranensis] Length = 433 Score = 77.0 bits (188), Expect = 3e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 +LPPTPAK+CDECGAPYLRETSKFCSECGSKRLG Sbjct: 399 MLPPTPAKYCDECGAPYLRETSKFCSECGSKRLG 432 >KHN25948.1 Hypothetical protein glysoja_018802 [Glycine soja] Length = 437 Score = 77.0 bits (188), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 403 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 437 >XP_003524832.1 PREDICTED: uncharacterized protein At2g02148-like [Glycine max] XP_006580075.1 PREDICTED: uncharacterized protein At2g02148-like [Glycine max] KRH58556.1 hypothetical protein GLYMA_05G135400 [Glycine max] KRH58557.1 hypothetical protein GLYMA_05G135400 [Glycine max] Length = 440 Score = 77.0 bits (188), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 406 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 440 >XP_007158844.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] XP_007158845.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] ESW30838.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] ESW30839.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] Length = 443 Score = 77.0 bits (188), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 409 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 443 >KYP61291.1 Uncharacterized protein At2g02148 family [Cajanus cajan] Length = 482 Score = 77.0 bits (188), Expect = 3e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 +LP TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 448 MLPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 482 >XP_004504627.1 PREDICTED: uncharacterized protein At2g02148 [Cicer arietinum] Length = 431 Score = 76.3 bits (186), Expect = 5e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 +LPP PAKFCDECGAPYLRETSKFCSECGSKRLG Sbjct: 397 MLPPAPAKFCDECGAPYLRETSKFCSECGSKRLG 430 >XP_017405639.1 PREDICTED: uncharacterized protein At2g02148 [Vigna angularis] BAT74208.1 hypothetical protein VIGAN_01182800 [Vigna angularis var. angularis] Length = 432 Score = 76.3 bits (186), Expect = 5e-14 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 ++P TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 398 MMPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 432 >XP_014509879.1 PREDICTED: uncharacterized protein At2g02148 isoform X1 [Vigna radiata var. radiata] XP_014509880.1 PREDICTED: uncharacterized protein At2g02148 isoform X1 [Vigna radiata var. radiata] Length = 432 Score = 76.3 bits (186), Expect = 5e-14 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 ++P TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 398 MMPTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 432 >OAY83831.1 Uncharacterized protein ACMD2_06292 [Ananas comosus] Length = 191 Score = 73.2 bits (178), Expect = 7e-14 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 LLP +PAKFCDECGAPYLRETSKFCSECG+KRLG Sbjct: 157 LLPSSPAKFCDECGAPYLRETSKFCSECGTKRLG 190 >GAU13766.1 hypothetical protein TSUD_82750 [Trifolium subterraneum] Length = 72 Score = 69.7 bits (169), Expect = 1e-13 Identities = 36/61 (59%), Positives = 45/61 (73%), Gaps = 3/61 (4%) Frame = +3 Query: 138 LNTHVIKRMMRDKRNMGIN---LSKSVMFPTSLNHTRSKTWMFPANMEPHIHHKTLQELV 308 +NT VI+RMMR R ++ L KSV F T+LN ++KTWMFP+NME HIHHKT Q+LV Sbjct: 1 MNTPVIERMMRVNRKTEMDYLGLYKSVKFLTALNRIQNKTWMFPSNMELHIHHKTSQDLV 60 Query: 309 A 311 A Sbjct: 61 A 61 >XP_014509882.1 PREDICTED: uncharacterized protein At2g02148 isoform X3 [Vigna radiata var. radiata] Length = 345 Score = 74.7 bits (182), Expect = 1e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 309 PPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 P TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 313 PTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 345 >XP_007158846.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] XP_007158847.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] ESW30840.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] ESW30841.1 hypothetical protein PHAVU_002G186800g [Phaseolus vulgaris] Length = 356 Score = 74.7 bits (182), Expect = 1e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 309 PPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 P TPAKFCDECGAPYLRETSKFCSECGSKRLGT Sbjct: 324 PTTPAKFCDECGAPYLRETSKFCSECGSKRLGT 356 >EYU30226.1 hypothetical protein MIMGU_mgv1a0120852mg, partial [Erythranthe guttata] Length = 177 Score = 71.6 bits (174), Expect = 2e-13 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 ++P +PAKFCDECG PYLRETSKFCSECG+KRLGT Sbjct: 143 VMPSSPAKFCDECGVPYLRETSKFCSECGTKRLGT 177 >OAY39100.1 hypothetical protein MANES_10G067600 [Manihot esculenta] Length = 222 Score = 72.4 bits (176), Expect = 2e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLG 214 L+P +PAKFCDECGAPYLRETSKFCSECG+KRLG Sbjct: 188 LMPASPAKFCDECGAPYLRETSKFCSECGTKRLG 221 >XP_010043890.1 PREDICTED: uncharacterized protein At2g02148 [Eucalyptus grandis] KCW85908.1 hypothetical protein EUGRSUZ_B02623 [Eucalyptus grandis] Length = 448 Score = 73.6 bits (179), Expect = 4e-13 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 315 LLPPTPAKFCDECGAPYLRETSKFCSECGSKRLGT 211 ++ P+PAKFCDECGAPYLRETSKFCSECG+KRLGT Sbjct: 414 IMAPSPAKFCDECGAPYLRETSKFCSECGAKRLGT 448