BLASTX nr result
ID: Glycyrrhiza34_contig00026519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026519 (640 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015936440.1 PREDICTED: TMV resistance protein N-like [Arachis... 80 7e-14 XP_003596685.1 disease resistance protein (TIR-NBS-LRR class) [M... 71 7e-13 XP_003596687.2 disease resistance protein (TIR-NBS-LRR class), p... 77 1e-12 KYP45064.1 TMV resistance protein N [Cajanus cajan] 77 1e-12 XP_013464813.1 disease resistance protein (TIR-NBS-LRR class), p... 75 5e-12 XP_003596679.2 disease resistance protein (TIR-NBS-LRR class), p... 75 5e-12 GAU26630.1 hypothetical protein TSUD_102380 [Trifolium subterran... 73 1e-11 KYP45065.1 TMV resistance protein N [Cajanus cajan] 73 2e-11 AHG28997.1 NBS-LRR protein [Cicer arietinum] 71 7e-11 XP_004492464.1 PREDICTED: TMV resistance protein N-like isoform ... 71 8e-11 XP_012569075.1 PREDICTED: TMV resistance protein N-like isoform ... 71 8e-11 XP_012569074.1 PREDICTED: TMV resistance protein N-like isoform ... 71 8e-11 XP_012569065.1 PREDICTED: TMV resistance protein N-like isoform ... 71 8e-11 XP_014522062.1 PREDICTED: disease resistance protein TAO1-like [... 70 3e-10 KRH27075.1 hypothetical protein GLYMA_12G212500 [Glycine max] 70 3e-10 KHN27958.1 TMV resistance protein N [Glycine soja] 70 3e-10 XP_014522068.1 PREDICTED: TMV resistance protein N-like isoform ... 69 6e-10 XP_014522064.1 PREDICTED: TMV resistance protein N-like isoform ... 69 7e-10 KYP43250.1 TMV resistance protein N [Cajanus cajan] 68 8e-10 KYP43256.1 TMV resistance protein N [Cajanus cajan] 68 1e-09 >XP_015936440.1 PREDICTED: TMV resistance protein N-like [Arachis duranensis] Length = 1253 Score = 80.1 bits (196), Expect = 7e-14 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ L+T LYSLKVLHLSGCT+LE+TPDFTG+SNLEYLD+++C SL Sbjct: 739 NLVSIDLNTEYKLYSLKVLHLSGCTKLENTPDFTGLSNLEYLDLEKCVSL 788 >XP_003596685.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES66936.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 73 Score = 70.9 bits (172), Expect = 7e-13 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV++ + SNL SL+VL LSGCT+LE TP+F G SNLEYLD+D CTSL+ Sbjct: 20 SLVNLDFGSVSNLCSLRVLRLSGCTKLEKTPNFMGASNLEYLDMDGCTSLF 70 >XP_003596687.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES66938.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1185 Score = 76.6 bits (187), Expect = 1e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 SLV++ SNLYSL+VL LSGCT+LE TPDFTG SNLEYLD+D CTSL Sbjct: 719 SLVNLDFGIVSNLYSLRVLRLSGCTKLEKTPDFTGASNLEYLDMDGCTSL 768 >KYP45064.1 TMV resistance protein N [Cajanus cajan] Length = 1356 Score = 76.6 bits (187), Expect = 1e-12 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS++ D SNL SL+VLHLSGCT+L++TPDFT +NLEYLDID CTSL Sbjct: 730 NLVSINFDKKSNLSSLRVLHLSGCTKLKNTPDFTSATNLEYLDIDGCTSL 779 >XP_013464813.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] KEH38848.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1193 Score = 74.7 bits (182), Expect = 5e-12 Identities = 39/52 (75%), Positives = 43/52 (82%), Gaps = 2/52 (3%) Frame = -3 Query: 638 SLVSVHLD--TASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ LD ASNLYSLKVLHLSGC++LE DF GVSNLEYLDIDQC SL Sbjct: 721 NLVSLVLDGHPASNLYSLKVLHLSGCSKLEIVSDFRGVSNLEYLDIDQCVSL 772 >XP_003596679.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES66930.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1282 Score = 74.7 bits (182), Expect = 5e-12 Identities = 39/52 (75%), Positives = 43/52 (82%), Gaps = 2/52 (3%) Frame = -3 Query: 638 SLVSVHLD--TASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ LD ASNLYSLKVLHLSGC++LE DF GVSNLEYLDIDQC SL Sbjct: 810 NLVSLVLDGHPASNLYSLKVLHLSGCSKLEIVSDFRGVSNLEYLDIDQCVSL 861 >GAU26630.1 hypothetical protein TSUD_102380 [Trifolium subterraneum] Length = 568 Score = 73.2 bits (178), Expect = 1e-11 Identities = 41/62 (66%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -3 Query: 617 DTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLYVC*A--QAHLEGLWKE 444 DT SNLYSLKVLHLSGC +LE PDFTGVSNLEYLDIDQ S +C + L L +E Sbjct: 361 DTISNLYSLKVLHLSGCPKLEMVPDFTGVSNLEYLDIDQ-LSFNLCRSSDSVQLLHLGEE 419 Query: 443 GQ 438 GQ Sbjct: 420 GQ 421 >KYP45065.1 TMV resistance protein N [Cajanus cajan] Length = 975 Score = 72.8 bits (177), Expect = 2e-11 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +L+S++ SNL SL+VLHLSGC +LE+TPDFT +NLEYLDID CTSL Sbjct: 711 NLISINFGDESNLCSLRVLHLSGCIKLENTPDFTSATNLEYLDIDGCTSL 760 >AHG28997.1 NBS-LRR protein [Cicer arietinum] Length = 883 Score = 71.2 bits (173), Expect = 7e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV + +AS L+SL+VL LSGCT+L+STPDFTG NLEYLD+D C SL+ Sbjct: 539 SLVHLDFGSASRLWSLRVLLLSGCTKLKSTPDFTGAINLEYLDVDHCASLF 589 >XP_004492464.1 PREDICTED: TMV resistance protein N-like isoform X4 [Cicer arietinum] Length = 1101 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV + +AS L+SL+VL LSGCT+L+STPDFTG NLEYLD+D C SL+ Sbjct: 704 SLVHLDFGSASRLWSLRVLLLSGCTKLKSTPDFTGAINLEYLDVDHCASLF 754 >XP_012569075.1 PREDICTED: TMV resistance protein N-like isoform X3 [Cicer arietinum] XP_012569076.1 PREDICTED: TMV resistance protein N-like isoform X3 [Cicer arietinum] Length = 1106 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV + +AS L+SL+VL LSGCT+L+STPDFTG NLEYLD+D C SL+ Sbjct: 704 SLVHLDFGSASRLWSLRVLLLSGCTKLKSTPDFTGAINLEYLDVDHCASLF 754 >XP_012569074.1 PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum] Length = 1118 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV + +AS L+SL+VL LSGCT+L+STPDFTG NLEYLD+D C SL+ Sbjct: 663 SLVHLDFGSASRLWSLRVLLLSGCTKLKSTPDFTGAINLEYLDVDHCASLF 713 >XP_012569065.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569066.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569067.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569068.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569069.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569070.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569071.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569072.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] XP_012569073.1 PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum] Length = 1159 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSLY 486 SLV + +AS L+SL+VL LSGCT+L+STPDFTG NLEYLD+D C SL+ Sbjct: 704 SLVHLDFGSASRLWSLRVLLLSGCTKLKSTPDFTGAINLEYLDVDHCASLF 754 >XP_014522062.1 PREDICTED: disease resistance protein TAO1-like [Vigna radiata var. radiata] Length = 971 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +L+S+ NL SL+VLH SGCT+LE+TPDFT NLEYLD D+CTSL Sbjct: 535 NLISIKFGNGFNLSSLRVLHFSGCTKLENTPDFTWTRNLEYLDFDECTSL 584 >KRH27075.1 hypothetical protein GLYMA_12G212500 [Glycine max] Length = 1190 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +L+S+ + NL SL+VLH SGCT+LE+TPDFT +NLEYLD D CTSL Sbjct: 712 NLISIKIGRGFNLISLRVLHFSGCTKLENTPDFTRTTNLEYLDFDGCTSL 761 >KHN27958.1 TMV resistance protein N [Glycine soja] Length = 1190 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +L+S+ + NL SL+VLH SGCT+LE+TPDFT +NLEYLD D CTSL Sbjct: 712 NLISIKIGRGFNLISLRVLHFSGCTKLENTPDFTRTTNLEYLDFDGCTSL 761 >XP_014522068.1 PREDICTED: TMV resistance protein N-like isoform X2 [Vigna radiata var. radiata] Length = 1032 Score = 68.6 bits (166), Expect = 6e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ N+ SL+VLHLSGC++LESTPDFT ++LEYLD+D CTSL Sbjct: 708 NLVSIDFGYVGNMSSLRVLHLSGCSKLESTPDFTRATHLEYLDMDACTSL 757 >XP_014522064.1 PREDICTED: TMV resistance protein N-like isoform X1 [Vigna radiata var. radiata] XP_014522065.1 PREDICTED: TMV resistance protein N-like isoform X1 [Vigna radiata var. radiata] XP_014522066.1 PREDICTED: TMV resistance protein N-like isoform X1 [Vigna radiata var. radiata] Length = 1177 Score = 68.6 bits (166), Expect = 7e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ N+ SL+VLHLSGC++LESTPDFT ++LEYLD+D CTSL Sbjct: 708 NLVSIDFGYVGNMSSLRVLHLSGCSKLESTPDFTRATHLEYLDMDACTSL 757 >KYP43250.1 TMV resistance protein N [Cajanus cajan] Length = 767 Score = 68.2 bits (165), Expect = 8e-10 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ D SNL SL VLHLSGCT+LE TP+FT NL+YLD D C SL Sbjct: 515 NLVSIDFDNGSNLSSLTVLHLSGCTKLECTPNFTRAKNLKYLDFDGCASL 564 >KYP43256.1 TMV resistance protein N [Cajanus cajan] Length = 934 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 638 SLVSVHLDTASNLYSLKVLHLSGCTRLESTPDFTGVSNLEYLDIDQCTSL 489 +LVS+ D SNL SL VLHLSGCT+LE TP+FT NL+YLD D C SL Sbjct: 686 NLVSIDFDNGSNLSSLTVLHLSGCTKLEYTPNFTKAENLKYLDFDGCASL 735