BLASTX nr result
ID: Glycyrrhiza34_contig00026301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026301 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ67759.1 DNA-directed RNA polymerases II, IV and V subunit 9B ... 73 1e-14 XP_011621573.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 73 1e-14 KVH90179.1 Zinc finger, TFIIS-type [Cynara cardunculus var. scol... 71 4e-14 EYU45501.1 hypothetical protein MIMGU_mgv1a023620mg, partial [Er... 71 5e-14 XP_012840388.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 5e-14 XP_019418809.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_018825558.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_017220665.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_016556063.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 KZV17022.1 DNA-directed RNA polymerase II, IV and V subunit 9A [... 71 6e-14 KVH87674.1 DNA-directed RNA polymerase, M/15kDa subunit [Cynara ... 71 6e-14 XP_003594777.1 DNA-directed RNA polymerase subunit [Medicago tru... 71 6e-14 XP_012453290.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_011071392.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_008340615.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_007035762.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_004487774.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_004239877.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_008438942.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 XP_003546327.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 71 6e-14 >KMZ67759.1 DNA-directed RNA polymerases II, IV and V subunit 9B [Zostera marina] Length = 114 Score = 72.8 bits (177), Expect = 1e-14 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_011621573.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Amborella trichopoda] Length = 114 Score = 72.8 bits (177), Expect = 1e-14 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 114 >KVH90179.1 Zinc finger, TFIIS-type [Cynara cardunculus var. scolymus] Length = 94 Score = 71.2 bits (173), Expect = 4e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 65 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 94 >EYU45501.1 hypothetical protein MIMGU_mgv1a023620mg, partial [Erythranthe guttata] Length = 104 Score = 71.2 bits (173), Expect = 5e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 75 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 104 >XP_012840388.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Erythranthe guttata] Length = 107 Score = 71.2 bits (173), Expect = 5e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 78 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 107 >XP_019418809.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Lupinus angustifolius] OIV95924.1 hypothetical protein TanjilG_27028 [Lupinus angustifolius] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_018825558.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9B [Juglans regia] XP_018825559.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9B [Juglans regia] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_017220665.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9B [Daucus carota subsp. sativus] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_016556063.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Capsicum annuum] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >KZV17022.1 DNA-directed RNA polymerase II, IV and V subunit 9A [Dorcoceras hygrometricum] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >KVH87674.1 DNA-directed RNA polymerase, M/15kDa subunit [Cynara cardunculus var. scolymus] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_003594777.1 DNA-directed RNA polymerase subunit [Medicago truncatula] ABD32320.1 DNA-directed RNA polymerase, subunit C11/M/9 [Medicago truncatula] ACJ85991.1 unknown [Medicago truncatula] AES65028.1 DNA-directed RNA polymerase subunit [Medicago truncatula] AFK36845.1 unknown [Medicago truncatula] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_012453290.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium raimondii] XP_016724235.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium hirsutum] XP_017640653.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium arboreum] KJB12663.1 hypothetical protein B456_002G030000 [Gossypium raimondii] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_011071392.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Sesamum indicum] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_008340615.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9B [Malus domestica] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_007035762.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Theobroma cacao] EOY06688.1 RNA polymerases M/15 Kd subunit [Theobroma cacao] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_004487774.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Cicer arietinum] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_004239877.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Solanum lycopersicum] XP_006355736.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Solanum tuberosum] XP_009607970.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Nicotiana tomentosiformis] XP_009800221.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Nicotiana sylvestris] XP_015075123.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Solanum pennellii] XP_016458637.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Nicotiana tabacum] XP_016477853.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Nicotiana tabacum] XP_019245277.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Nicotiana attenuata] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_008438942.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Cucumis melo] XP_011651080.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Cucumis sativus] KGN57159.1 hypothetical protein Csa_3G166240 [Cucumis sativus] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114 >XP_003546327.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A-like [Glycine max] KRH11971.1 hypothetical protein GLYMA_15G142700 [Glycine max] Length = 114 Score = 71.2 bits (173), Expect = 6e-14 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 299 VFFQAAARGEEGMTLFFVCCNPNCGHRWRD 210 VFFQA ARGEEGMTLFFVCCNPNCGHRWRD Sbjct: 85 VFFQATARGEEGMTLFFVCCNPNCGHRWRD 114