BLASTX nr result
ID: Glycyrrhiza34_contig00026216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026216 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014631224.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 71 8e-13 XP_014631222.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 71 8e-13 KHN06525.1 Protein Skeletor, isoforms D/E [Glycine soja] 71 8e-13 KHN06524.1 Protein Skeletor, isoforms B/C [Glycine soja] 71 8e-13 XP_003524244.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 71 8e-13 XP_003524243.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 71 8e-13 KHN29000.1 Putative ferric-chelate reductase 1 [Glycine soja] 71 8e-13 XP_019435091.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 67 3e-11 XP_014510414.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 67 3e-11 XP_014510413.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 67 3e-11 XP_007159680.1 hypothetical protein PHAVU_002G258100g [Phaseolus... 66 5e-11 XP_007224055.1 hypothetical protein PRUPE_ppa015250mg [Prunus pe... 66 6e-11 XP_017409463.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 65 2e-10 XP_019430888.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 64 2e-10 XP_014510628.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 64 3e-10 XP_017412015.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 63 6e-10 XP_008220693.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b561, ... 63 6e-10 XP_004485991.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 63 6e-10 KYP67595.1 Putative ferric-chelate reductase 1 [Cajanus cajan] 60 1e-08 XP_008377667.1 PREDICTED: cytochrome b561, DM13 and DOMON domain... 60 1e-08 >XP_014631224.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X4 [Glycine max] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >XP_014631222.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X2 [Glycine max] XP_014631223.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X3 [Glycine max] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >KHN06525.1 Protein Skeletor, isoforms D/E [Glycine soja] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >KHN06524.1 Protein Skeletor, isoforms B/C [Glycine soja] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >XP_003524244.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Glycine max] KRH59220.1 hypothetical protein GLYMA_05G172000 [Glycine max] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >XP_003524243.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X1 [Glycine max] KRH59219.1 hypothetical protein GLYMA_05G171900 [Glycine max] Length = 878 Score = 71.2 bits (173), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S VVNSESEF MVQHQLRGSLKI DDC Sbjct: 18 GYADPAPNCTRLSSVVNSESEFEMVQHQLRGSLKIRDDC 56 >KHN29000.1 Putative ferric-chelate reductase 1 [Glycine soja] Length = 884 Score = 71.2 bits (173), Expect = 8e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP PNC+R+S +VNSESEF MVQHQLRGSLKI DDC Sbjct: 20 GYADPAPNCTRLSSIVNSESEFEMVQHQLRGSLKINDDC 58 >XP_019435091.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] OIV89184.1 hypothetical protein TanjilG_25390 [Lupinus angustifolius] Length = 884 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+AD PNC+RV+P+V+SESEF MVQHQLRGSLKI DDC Sbjct: 16 GYADADPNCTRVNPLVDSESEFKMVQHQLRGSLKIIDDC 54 >XP_014510414.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X2 [Vigna radiata var. radiata] Length = 841 Score = 66.6 bits (161), Expect = 3e-11 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -2 Query: 173 MLRRXXXXXXXXXXXXXSGHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 MLRR +ADP PNC+R S +V+SES+F MVQHQLRGSLKITDDC Sbjct: 1 MLRRSLFLPFLFHFLLLFRYADPAPNCTRDSSLVDSESQFEMVQHQLRGSLKITDDC 57 >XP_014510413.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X1 [Vigna radiata var. radiata] Length = 878 Score = 66.6 bits (161), Expect = 3e-11 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -2 Query: 173 MLRRXXXXXXXXXXXXXSGHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 MLRR +ADP PNC+R S +V+SES+F MVQHQLRGSLKITDDC Sbjct: 1 MLRRSLFLPFLFHFLLLFRYADPAPNCTRDSSLVDSESQFEMVQHQLRGSLKITDDC 57 >XP_007159680.1 hypothetical protein PHAVU_002G258100g [Phaseolus vulgaris] ESW31674.1 hypothetical protein PHAVU_002G258100g [Phaseolus vulgaris] Length = 878 Score = 66.2 bits (160), Expect = 5e-11 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = -2 Query: 173 MLRRXXXXXXXXXXXXXSGHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 MLRR +ADP PNC+R S +++SES+F MVQHQLRGSLKITDDC Sbjct: 1 MLRRSLFLPFLLHFLLLFRYADPAPNCTRDSSLIDSESQFEMVQHQLRGSLKITDDC 57 >XP_007224055.1 hypothetical protein PRUPE_ppa015250mg [Prunus persica] ONI32888.1 hypothetical protein PRUPE_1G391800 [Prunus persica] Length = 904 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 116 HADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 HADP NC + SP+VNSESEF MVQHQLRGS+KI DDC Sbjct: 21 HADPGSNCPKTSPLVNSESEFKMVQHQLRGSIKIIDDC 58 >XP_017409463.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Vigna angularis] KOM30777.1 hypothetical protein LR48_Vigan01g033200 [Vigna angularis] Length = 878 Score = 64.7 bits (156), Expect = 2e-10 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = -2 Query: 173 MLRRXXXXXXXXXXXXXSGHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 MLRR +ADP PNC+R S +V+SES+F MVQHQLRGSLKIT+DC Sbjct: 1 MLRRSLFLPFIFHLLLLFRYADPAPNCTRDSSLVDSESQFEMVQHQLRGSLKITNDC 57 >XP_019430888.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430889.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430890.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430891.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430892.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430893.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430894.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430895.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430897.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430898.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] XP_019430899.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lupinus angustifolius] Length = 905 Score = 64.3 bits (155), Expect = 2e-10 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 116 HADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 HADP PNC+R +P+V+SESEF +VQHQLRG +KI DDC Sbjct: 19 HADPNPNCNRTNPLVDSESEFKLVQHQLRGYIKIIDDC 56 >XP_014510628.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Vigna radiata var. radiata] Length = 879 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP NC+R SPVV+SES F MVQHQ+RGSLKI DDC Sbjct: 20 GYADPARNCTRDSPVVDSESAFEMVQHQVRGSLKIRDDC 58 >XP_017412015.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Vigna angularis] KOM30778.1 hypothetical protein LR48_Vigan01g033300 [Vigna angularis] BAT73453.1 hypothetical protein VIGAN_01093700 [Vigna angularis var. angularis] Length = 879 Score = 63.2 bits (152), Expect = 6e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP NC+R SPVV+SES F MVQHQ+RGSLKI DDC Sbjct: 20 GYADPARNCTRDSPVVDSESIFEMVQHQVRGSLKIRDDC 58 >XP_008220693.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Prunus mume] Length = 897 Score = 63.2 bits (152), Expect = 6e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 116 HADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 +ADP NC + SP+VNSESEF MVQHQLRGS+KI DDC Sbjct: 21 NADPGSNCPKTSPLVNSESEFKMVQHQLRGSIKIIDDC 58 >XP_004485991.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Cicer arietinum] Length = 900 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 119 GHADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 G+ADP P CSR SP ++ ESEF MVQHQLRG +KI DDC Sbjct: 16 GYADPAPKCSRSSPFIDFESEFKMVQHQLRGKIKIIDDC 54 >KYP67595.1 Putative ferric-chelate reductase 1 [Cajanus cajan] Length = 874 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 116 HADPVPNCSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 +AD PNC+R++ +VN ESEF MVQHQLRGSL+I DDC Sbjct: 16 YADSAPNCTRLTSLVNLESEFQMVQHQLRGSLQIIDDC 53 >XP_008377667.1 PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Malus domestica] Length = 909 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -2 Query: 116 HADPVPN-CSRVSPVVNSESEFTMVQHQLRGSLKITDDC 3 HADPV + C + SP+VNSESEF M+QHQLRGS++I DDC Sbjct: 22 HADPVSSDCPKTSPLVNSESEFKMLQHQLRGSIRIIDDC 60