BLASTX nr result
ID: Glycyrrhiza34_contig00026175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00026175 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004497286.2 PREDICTED: pentatricopeptide repeat-containing pr... 156 1e-42 XP_013470312.1 pentatricopeptide (PPR) repeat protein [Medicago ... 150 2e-40 KYP66728.1 Pentatricopeptide repeat-containing protein At5g39350... 143 5e-38 XP_015944483.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-37 XP_017426180.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 1e-36 XP_019441726.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 1e-36 XP_016180921.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 3e-36 XP_007156911.1 hypothetical protein PHAVU_002G027600g [Phaseolus... 138 5e-36 XP_003516575.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 1e-35 KHN36137.1 Pentatricopeptide repeat-containing protein [Glycine ... 133 5e-34 XP_014520302.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 4e-22 XP_012489629.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 1e-20 XP_012489627.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 1e-20 XP_016695266.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 5e-20 XP_016695265.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 5e-20 XP_016708803.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 1e-19 XP_017629634.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 2e-19 XP_010553976.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 1e-18 XP_018816536.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 1e-18 XP_012081219.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 >XP_004497286.2 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Cicer arietinum] Length = 667 Score = 156 bits (395), Expect = 1e-42 Identities = 77/106 (72%), Positives = 88/106 (83%) Frame = +1 Query: 4 AMNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYA 183 AMNKG R S + +QCESLLR+YS SNSL ETKKLHA I+T G L SQLCSKLATTYA Sbjct: 4 AMNKG--RFFSISASQCESLLRKYSDSNSLLETKKLHALIITCGTLSSSQLCSKLATTYA 61 Query: 184 RCYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 +C+H SYAS +FDKLP RSLFSWNTM+ M+VQMGRPHD L++FVEM Sbjct: 62 QCHHVSYASHMFDKLPKRSLFSWNTMIRMYVQMGRPHDALNMFVEM 107 >XP_013470312.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH44350.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 710 Score = 150 bits (380), Expect = 2e-40 Identities = 76/105 (72%), Positives = 86/105 (81%) Frame = +1 Query: 7 MNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYAR 186 MNK R + + ESLLR+YSASNSLSETKKLHA I+T GL SQL SKLATTYA+ Sbjct: 1 MNKAN-RFFTIAASHFESLLRKYSASNSLSETKKLHALIITYGLFSSSQLSSKLATTYAQ 59 Query: 187 CYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 C+HASYASQLFDKLP R+LFSWNTMM M+VQMGRPHD L++FVEM Sbjct: 60 CHHASYASQLFDKLPKRNLFSWNTMMRMYVQMGRPHDALNMFVEM 104 >KYP66728.1 Pentatricopeptide repeat-containing protein At5g39350 family [Cajanus cajan] Length = 597 Score = 143 bits (361), Expect = 5e-38 Identities = 70/95 (73%), Positives = 79/95 (83%) Frame = +1 Query: 37 TTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHASYASQL 216 T AQCESLLR++SAS SLSETKKLHA ILT GL S +CSKLATTYA+C+HASYAS L Sbjct: 4 TIAAQCESLLRKFSASQSLSETKKLHALILTLGLFSSSNICSKLATTYAQCHHASYASHL 63 Query: 217 FDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 FDKLP SLFSWN +M M+VQ+GRP D L+LFVEM Sbjct: 64 FDKLPQPSLFSWNALMRMYVQIGRPLDALNLFVEM 98 >XP_015944483.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Arachis duranensis] XP_015944484.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Arachis duranensis] XP_015944486.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Arachis duranensis] Length = 673 Score = 142 bits (358), Expect = 2e-37 Identities = 69/92 (75%), Positives = 78/92 (84%) Frame = +1 Query: 46 AQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHASYASQLFDK 225 A+CE LLRRYSAS+SLSETKKLHAFILT GLL S CS L+T+YA+C HASYAS LFD Sbjct: 19 AKCELLLRRYSASHSLSETKKLHAFILTLGLLSSSDFCSMLSTSYAQCSHASYASHLFDN 78 Query: 226 LPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 LP RSLFSWNTMM M+VQ+GRPH+ L+LF EM Sbjct: 79 LPRRSLFSWNTMMRMYVQIGRPHNALNLFAEM 110 >XP_017426180.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Vigna angularis] KOM45119.1 hypothetical protein LR48_Vigan06g042500 [Vigna angularis] BAU00116.1 hypothetical protein VIGAN_10168300 [Vigna angularis var. angularis] Length = 667 Score = 140 bits (352), Expect = 1e-36 Identities = 68/99 (68%), Positives = 80/99 (80%) Frame = +1 Query: 25 RLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHASY 204 +++ TT AQCESLLR+ S+ S SETKKLHAF+LT GL +LCSKLATTYA+C+HASY Sbjct: 5 KMLVTTAAQCESLLRKCSSLQSFSETKKLHAFMLTLGLFSSPELCSKLATTYAQCHHASY 64 Query: 205 ASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 AS LF KLP SLFSWN MM M+VQ+GRP D L+LFVEM Sbjct: 65 ASHLFKKLPQPSLFSWNAMMRMYVQIGRPFDALNLFVEM 103 >XP_019441726.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Lupinus angustifolius] OIW12730.1 hypothetical protein TanjilG_24663 [Lupinus angustifolius] Length = 669 Score = 140 bits (352), Expect = 1e-36 Identities = 74/105 (70%), Positives = 85/105 (80%) Frame = +1 Query: 7 MNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYAR 186 MNKG K +S T QCESLLR+YS+SNSLS+TK+LHAFILT GL S+L S LATTYA+ Sbjct: 4 MNKG-KNFMSIAT-QCESLLRKYSSSNSLSQTKQLHAFILTYGLFSSSRLSSILATTYAQ 61 Query: 187 CYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 C HASYAS LFD L R+L+SWNTMM M VQ+GRPHD L+LFVEM Sbjct: 62 CNHASYASYLFDNLTQRTLYSWNTMMRMNVQIGRPHDALNLFVEM 106 >XP_016180921.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Arachis ipaensis] Length = 673 Score = 139 bits (350), Expect = 3e-36 Identities = 68/92 (73%), Positives = 77/92 (83%) Frame = +1 Query: 46 AQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHASYASQLFDK 225 A+CESLLRRYSAS+ LSETKKLHAFILT GLL S CS L+T+YA+C HASYAS LFD Sbjct: 19 AKCESLLRRYSASHLLSETKKLHAFILTLGLLSSSDFCSMLSTSYAQCSHASYASHLFDN 78 Query: 226 LPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 LP RSLFSWNTMM M+VQ+GRP + L+LF EM Sbjct: 79 LPRRSLFSWNTMMRMYVQIGRPRNALNLFAEM 110 >XP_007156911.1 hypothetical protein PHAVU_002G027600g [Phaseolus vulgaris] ESW28905.1 hypothetical protein PHAVU_002G027600g [Phaseolus vulgaris] Length = 667 Score = 138 bits (348), Expect = 5e-36 Identities = 70/105 (66%), Positives = 82/105 (78%) Frame = +1 Query: 7 MNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYAR 186 M KG ++ T AQCESLLR++S+ S SETKKLHA +LT GL S LCSKLATTYA+ Sbjct: 1 MKKGTMFMI--TAAQCESLLRKFSSLQSFSETKKLHALMLTLGLFSSSDLCSKLATTYAQ 58 Query: 187 CYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 C+HASYAS LF+KLP SLFSWN MM M+VQ+GRP D L+LFVEM Sbjct: 59 CHHASYASHLFNKLPQPSLFSWNAMMRMYVQIGRPLDALNLFVEM 103 >XP_003516575.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] XP_006573586.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] XP_006573587.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] XP_014631427.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] XP_014631432.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] KRH76830.1 hypothetical protein GLYMA_01G176700 [Glycine max] KRH76831.1 hypothetical protein GLYMA_01G176700 [Glycine max] Length = 666 Score = 137 bits (346), Expect = 1e-35 Identities = 70/105 (66%), Positives = 81/105 (77%) Frame = +1 Query: 7 MNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYAR 186 M KG + +TT AQCESLL ++SAS S SETK+LHA ILT G+ S LCSKLATTYA+ Sbjct: 1 MKKG--MMFATTAAQCESLLGKFSASQSHSETKRLHALILTLGIFSSSNLCSKLATTYAQ 58 Query: 187 CYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 C+HASYAS LFDKL LFSWN MM M+VQ+GRP D L+LFVEM Sbjct: 59 CHHASYASHLFDKLSQPCLFSWNAMMRMYVQIGRPFDALNLFVEM 103 >KHN36137.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 696 Score = 133 bits (334), Expect = 5e-34 Identities = 68/105 (64%), Positives = 79/105 (75%) Frame = +1 Query: 7 MNKGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYAR 186 M KG + + T AQCESLL ++SAS SETK+LHA ILT G+ S LCSKLATTYA+ Sbjct: 1 MKKG--MMFAITAAQCESLLGKFSASQFHSETKRLHALILTLGIFSSSNLCSKLATTYAQ 58 Query: 187 CYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 C+HASYAS LFDKL LFSWN MM M+VQ+GRP D L+LFVEM Sbjct: 59 CHHASYASHLFDKLSQPCLFSWNAMMRMYVQIGRPFDALNLFVEM 103 >XP_014520302.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Vigna radiata var. radiata] Length = 631 Score = 99.4 bits (246), Expect = 4e-22 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = +1 Query: 121 ILTSGLLPWSQLCSKLATTYARCYHASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDT 300 +LT GL S+LC KLATTYA+C+HASYAS LF KLP SLFSWN MM M+VQ+GRP D Sbjct: 1 MLTLGLFSSSELCCKLATTYAQCHHASYASHLFKKLPQPSLFSWNAMMRMYVQIGRPFDA 60 Query: 301 LHLFVEM 321 L+LFVEM Sbjct: 61 LNLFVEM 67 >XP_012489629.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 isoform X2 [Gossypium raimondii] Length = 665 Score = 95.1 bits (235), Expect = 1e-20 Identities = 49/101 (48%), Positives = 70/101 (69%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHA 198 G+ LV + QC+SLL+ Y A+ SL+ET +LHA I+TSGLL LCS L+ +YA C H Sbjct: 3 GQSLVLSKGKQCKSLLKHYIAAKSLTETTQLHALIITSGLLS-PHLCSDLSCSYACCGHI 61 Query: 199 SYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++PH +LF +N M+ M+ + G +TL+LF+EM Sbjct: 62 DTARKLFDEIPHPTLFPYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_012489627.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 isoform X1 [Gossypium raimondii] KJB40887.1 hypothetical protein B456_007G081600 [Gossypium raimondii] Length = 689 Score = 95.1 bits (235), Expect = 1e-20 Identities = 49/101 (48%), Positives = 70/101 (69%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHA 198 G+ LV + QC+SLL+ Y A+ SL+ET +LHA I+TSGLL LCS L+ +YA C H Sbjct: 3 GQSLVLSKGKQCKSLLKHYIAAKSLTETTQLHALIITSGLLS-PHLCSDLSCSYACCGHI 61 Query: 199 SYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++PH +LF +N M+ M+ + G +TL+LF+EM Sbjct: 62 DTARKLFDEIPHPTLFPYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_016695266.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like isoform X2 [Gossypium hirsutum] Length = 665 Score = 93.6 bits (231), Expect = 5e-20 Identities = 48/101 (47%), Positives = 70/101 (69%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHA 198 G+ LV + QC+SLL+ Y A+ SL++T +LHA I+TSGLL LCS L+ +YA C H Sbjct: 3 GQSLVLSKGKQCKSLLKHYIAAKSLTKTTQLHALIITSGLLS-PHLCSDLSCSYACCGHI 61 Query: 199 SYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++PH +LF +N M+ M+ + G +TL+LF+EM Sbjct: 62 DTARKLFDEIPHPTLFPYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_016695265.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like isoform X1 [Gossypium hirsutum] Length = 719 Score = 93.6 bits (231), Expect = 5e-20 Identities = 48/101 (47%), Positives = 70/101 (69%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHA 198 G+ LV + QC+SLL+ Y A+ SL++T +LHA I+TSGLL LCS L+ +YA C H Sbjct: 3 GQSLVLSKGKQCKSLLKHYIAAKSLTKTTQLHALIITSGLLS-PHLCSDLSCSYACCGHI 61 Query: 199 SYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++PH +LF +N M+ M+ + G +TL+LF+EM Sbjct: 62 DTARKLFDEIPHPTLFPYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_016708803.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Gossypium hirsutum] Length = 665 Score = 92.4 bits (228), Expect = 1e-19 Identities = 48/101 (47%), Positives = 71/101 (70%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCYHA 198 G+ LV + QC+SLL+ Y A+ SL++T +LHA I+TSGLL LCS L+ +YA C H Sbjct: 3 GQSLVFSKGKQCKSLLKHYIAAKSLTKTTQLHALIITSGLLS-PYLCSDLSCSYACCGHI 61 Query: 199 SYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++P+ +LFS+N M+ M+ + G +TL+LF+EM Sbjct: 62 DTARKLFDEIPNPTLFSYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_017629634.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Gossypium arboreum] Length = 665 Score = 92.0 bits (227), Expect = 2e-19 Identities = 49/102 (48%), Positives = 73/102 (71%), Gaps = 1/102 (0%) Frame = +1 Query: 19 GKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLL-PWSQLCSKLATTYARCYH 195 G+ LV + QC+SLL+ Y A+ SL++T +LHA I+TSGLL P+ LCS L+ +YA C H Sbjct: 3 GQSLVLSKGKQCKSLLKHYIAAKSLTKTTQLHALIITSGLLIPY--LCSDLSCSYACCGH 60 Query: 196 ASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 A +LFD++P+ +LFS+N M+ M+ + G +TL+LF+EM Sbjct: 61 IDTARKLFDEIPNPTLFSYNMMLKMYTKNGFYLETLNLFLEM 102 >XP_010553976.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Tarenaya hassleriana] Length = 673 Score = 89.7 bits (221), Expect = 1e-18 Identities = 48/103 (46%), Positives = 65/103 (63%) Frame = +1 Query: 13 KGGKRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWSQLCSKLATTYARCY 192 KGGK + T QC+SLL Y+A+ S+S+TK LH ++T G L L S L TYA C Sbjct: 7 KGGKAKHALTIKQCQSLLNHYAATQSISKTKALHCHVITGGHLS-HHLRSSLFITYALCD 65 Query: 193 HASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 H SYA +LFD+LP SL S+N + M+V+ G D +++FV M Sbjct: 66 HISYARKLFDELPQSSLLSFNIAIRMYVRDGLYQDAVNVFVRM 108 >XP_018816536.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Juglans regia] Length = 677 Score = 89.7 bits (221), Expect = 1e-18 Identities = 44/103 (42%), Positives = 71/103 (68%), Gaps = 3/103 (2%) Frame = +1 Query: 22 KRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPWS---QLCSKLATTYARCY 192 K L++TT AQC+SL R ++A+ SL++ K+LHA + SGLL S ++ S +A YA C Sbjct: 12 KHLLATTAAQCQSLFRNFAATRSLTKIKQLHAHTIISGLLSSSKSTEIRSAVAAAYALCG 71 Query: 193 HASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 +A +LFD++ RSLF +N ++ M++Q G P+D L++FV++ Sbjct: 72 DVRFARKLFDEVSDRSLFLYNVVIRMYIQNGLPYDALNVFVQL 114 >XP_012081219.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Jatropha curcas] Length = 674 Score = 86.7 bits (213), Expect = 1e-17 Identities = 44/103 (42%), Positives = 67/103 (65%), Gaps = 3/103 (2%) Frame = +1 Query: 22 KRLVSTTTAQCESLLRRYSASNSLSETKKLHAFILTSGLLPW---SQLCSKLATTYARCY 192 K L+++TT Q SLL Y+A+ SL++TK+LHA +T+GLL S++ S L Y C Sbjct: 12 KHLLTSTTTQYMSLLEHYTATKSLTKTKQLHAHTITAGLLSSPESSRVRSSLVVAYMHCR 71 Query: 193 HASYASQLFDKLPHRSLFSWNTMMSMFVQMGRPHDTLHLFVEM 321 H + +LFD+LP R+ F +N +M+M+V +G D + +FVEM Sbjct: 72 HVPHTRKLFDELPERNAFLYNNLMTMYVNLGLYLDVIKVFVEM 114