BLASTX nr result
ID: Glycyrrhiza34_contig00025983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025983 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007140326.1 hypothetical protein PHAVU_008G1030001g, partial ... 86 4e-20 BAT84468.1 hypothetical protein VIGAN_04185900 [Vigna angularis ... 86 2e-18 KOM38020.1 hypothetical protein LR48_Vigan03g140200 [Vigna angul... 86 4e-17 XP_016195598.1 PREDICTED: telomere repeat-binding protein 5-like... 86 4e-17 KYP44903.1 Telomere-binding protein 1 [Cajanus cajan] 86 4e-17 XP_003551477.1 PREDICTED: telomere repeat-binding protein 5-like... 86 4e-17 XP_017416621.1 PREDICTED: telomere repeat-binding protein 5-like... 86 4e-17 XP_015960714.1 PREDICTED: telomere repeat-binding protein 5-like... 86 4e-17 XP_006583593.1 PREDICTED: telomere repeat-binding protein 5-like... 84 2e-16 KRH49112.1 hypothetical protein GLYMA_07G133000 [Glycine max] 84 2e-16 KHN40297.1 Telomere repeat-binding protein 5 [Glycine soja] 84 2e-16 XP_003530208.1 PREDICTED: telomere repeat-binding protein 5-like... 84 2e-16 OIW07481.1 hypothetical protein TanjilG_14427 [Lupinus angustifo... 83 2e-16 XP_019450228.1 PREDICTED: telomere repeat-binding protein 4-like... 83 2e-16 GAU38812.1 hypothetical protein TSUD_163870 [Trifolium subterran... 82 8e-16 XP_004492361.1 PREDICTED: telomere repeat-binding protein 6-like... 82 8e-16 XP_019459583.1 PREDICTED: telomere repeat-binding protein 5-like... 80 4e-15 XP_013448864.1 double-strand telomere-binding protein, putative ... 79 7e-15 XP_010106503.1 Telomere repeat-binding protein 5 [Morus notabili... 77 3e-14 EOY34005.1 TRF-like 2, putative isoform 2 [Theobroma cacao] 76 8e-14 >XP_007140326.1 hypothetical protein PHAVU_008G1030001g, partial [Phaseolus vulgaris] ESW12320.1 hypothetical protein PHAVU_008G1030001g, partial [Phaseolus vulgaris] Length = 49 Score = 85.5 bits (210), Expect = 4e-20 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 11 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 49 >BAT84468.1 hypothetical protein VIGAN_04185900 [Vigna angularis var. angularis] Length = 206 Score = 85.5 bits (210), Expect = 2e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 168 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 206 >KOM38020.1 hypothetical protein LR48_Vigan03g140200 [Vigna angularis] Length = 547 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 509 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 547 >XP_016195598.1 PREDICTED: telomere repeat-binding protein 5-like [Arachis ipaensis] Length = 596 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 558 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 596 >KYP44903.1 Telomere-binding protein 1 [Cajanus cajan] Length = 596 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 558 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 596 >XP_003551477.1 PREDICTED: telomere repeat-binding protein 5-like [Glycine max] XP_006602594.1 PREDICTED: telomere repeat-binding protein 5-like [Glycine max] KHN13992.1 Telomere repeat-binding protein 2 [Glycine soja] KRG99966.1 hypothetical protein GLYMA_18G182400 [Glycine max] KRG99967.1 hypothetical protein GLYMA_18G182400 [Glycine max] Length = 603 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 565 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 603 >XP_017416621.1 PREDICTED: telomere repeat-binding protein 5-like [Vigna angularis] Length = 604 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 566 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 604 >XP_015960714.1 PREDICTED: telomere repeat-binding protein 5-like [Arachis duranensis] Length = 616 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL Sbjct: 578 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 616 >XP_006583593.1 PREDICTED: telomere repeat-binding protein 5-like isoform X2 [Glycine max] Length = 494 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQ QCKHQLKPL Sbjct: 456 RISPQQRRGEPVPQELLDRVLAAHAYWSQHQCKHQLKPL 494 >KRH49112.1 hypothetical protein GLYMA_07G133000 [Glycine max] Length = 549 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQ QCKHQLKPL Sbjct: 511 RISPQQRRGEPVPQELLDRVLAAHAYWSQHQCKHQLKPL 549 >KHN40297.1 Telomere repeat-binding protein 5 [Glycine soja] Length = 606 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQ QCKHQLKPL Sbjct: 568 RISPQQRRGEPVPQELLDRVLAAHAYWSQHQCKHQLKPL 606 >XP_003530208.1 PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Glycine max] XP_006583591.1 PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Glycine max] XP_006583592.1 PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Glycine max] KRH49110.1 hypothetical protein GLYMA_07G133000 [Glycine max] KRH49111.1 hypothetical protein GLYMA_07G133000 [Glycine max] Length = 606 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQ QCKHQLKPL Sbjct: 568 RISPQQRRGEPVPQELLDRVLAAHAYWSQHQCKHQLKPL 606 >OIW07481.1 hypothetical protein TanjilG_14427 [Lupinus angustifolius] Length = 557 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVL AHAYWSQQQCKHQLKP+ Sbjct: 519 RISPQQRRGEPVPQELLDRVLTAHAYWSQQQCKHQLKPM 557 >XP_019450228.1 PREDICTED: telomere repeat-binding protein 4-like [Lupinus angustifolius] XP_019450229.1 PREDICTED: telomere repeat-binding protein 4-like [Lupinus angustifolius] XP_019450230.1 PREDICTED: telomere repeat-binding protein 4-like [Lupinus angustifolius] XP_019450231.1 PREDICTED: telomere repeat-binding protein 4-like [Lupinus angustifolius] XP_019450232.1 PREDICTED: telomere repeat-binding protein 4-like [Lupinus angustifolius] Length = 578 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVL AHAYWSQQQCKHQLKP+ Sbjct: 540 RISPQQRRGEPVPQELLDRVLTAHAYWSQQQCKHQLKPM 578 >GAU38812.1 hypothetical protein TSUD_163870 [Trifolium subterraneum] Length = 598 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLK + Sbjct: 560 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKSM 598 >XP_004492361.1 PREDICTED: telomere repeat-binding protein 6-like [Cicer arietinum] Length = 601 Score = 81.6 bits (200), Expect = 8e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQ+K L Sbjct: 563 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQIKSL 601 >XP_019459583.1 PREDICTED: telomere repeat-binding protein 5-like [Lupinus angustifolius] OIW01240.1 hypothetical protein TanjilG_10401 [Lupinus angustifolius] Length = 579 Score = 79.7 bits (195), Expect = 4e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVL AHAYWSQQQCKHQLK + Sbjct: 541 RISPQQRRGEPVPQELLDRVLIAHAYWSQQQCKHQLKAM 579 >XP_013448864.1 double-strand telomere-binding protein, putative [Medicago truncatula] KEH22891.1 double-strand telomere-binding protein, putative [Medicago truncatula] Length = 611 Score = 79.0 bits (193), Expect = 7e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVL+AHAYWSQQQCKHQ K + Sbjct: 573 RISPQQRRGEPVPQELLDRVLSAHAYWSQQQCKHQFKSM 611 >XP_010106503.1 Telomere repeat-binding protein 5 [Morus notabilis] EXC10679.1 Telomere repeat-binding protein 5 [Morus notabilis] Length = 720 Score = 77.4 bits (189), Expect = 3e-14 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 119 RISPQQRRGEPVPQELLDRVL AHAYWSQQQ K QLKPL Sbjct: 675 RISPQQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPL 713 >EOY34005.1 TRF-like 2, putative isoform 2 [Theobroma cacao] Length = 517 Score = 75.9 bits (185), Expect = 8e-14 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +3 Query: 3 RISPQQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKP 116 RISPQQRRGEPVPQELLDRVL AHAYWSQQQ K QLKP Sbjct: 452 RISPQQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKP 489