BLASTX nr result
ID: Glycyrrhiza34_contig00025974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025974 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018828531.1 PREDICTED: exocyst complex component EXO70B1-like... 57 7e-07 XP_008349534.1 PREDICTED: exocyst complex component EXO70B1-like... 54 8e-06 >XP_018828531.1 PREDICTED: exocyst complex component EXO70B1-like [Juglans regia] Length = 645 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 428 EVLESNLKASSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 297 E+LESNL+A SKIYKDS+L ++ M+NN RY+VHK K EL +L Sbjct: 464 ELLESNLEAKSKIYKDSALSYLFMMNNGRYIVHKVKDSELALLL 507 >XP_008349534.1 PREDICTED: exocyst complex component EXO70B1-like [Malus domestica] Length = 634 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 428 EVLESNLKASSKIYKDSSLGFVLMVNNWRYMVHKAKRCELRKVL 297 E+LESNL+A SKIY+DS+L +V M+NN RY+V KAK EL +L Sbjct: 451 ELLESNLEAKSKIYRDSALCYVFMMNNGRYIVQKAKDSELGLLL 494