BLASTX nr result
ID: Glycyrrhiza34_contig00025938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025938 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019452251.1 PREDICTED: serine--tRNA ligase-like isoform X1 [L... 65 1e-10 XP_019419668.1 PREDICTED: serine--tRNA ligase-like isoform X1 [L... 55 9e-07 >XP_019452251.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] Length = 481 Score = 65.5 bits (158), Expect = 1e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 254 PNNEAKGASKHVQFNRAAHILNSITKFLGKRNAFWKIGPRIFN 126 P E +GA KHVQ NRA HILNSITKF+GK+NA WK G RIF+ Sbjct: 436 PVKEPRGALKHVQVNRAHHILNSITKFIGKKNAAWKFGTRIFS 478 >XP_019419668.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] XP_019419669.1 PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] Length = 481 Score = 54.7 bits (130), Expect = 9e-07 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -1 Query: 254 PNNEAKGASKHVQFNRAAHILNSITKFLGKRNAFWKIGPRIFN 126 P EAKGA K VQFNRAA + SIT F K FWKIG R+FN Sbjct: 436 PVAEAKGALKRVQFNRAASTMTSITSFFEKWKNFWKIGTRLFN 478