BLASTX nr result
ID: Glycyrrhiza34_contig00025906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025906 (494 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016171006.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 4e-28 XP_015940619.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 1e-26 XP_019414190.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-26 XP_016176352.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-25 XP_015960371.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 1e-24 XP_015960370.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 1e-24 OAY31699.1 hypothetical protein MANES_14G133200 [Manihot esculenta] 107 4e-24 OMO64857.1 hypothetical protein COLO4_31777 [Corchorus olitorius] 103 8e-23 OMO76815.1 hypothetical protein CCACVL1_15401 [Corchorus capsula... 103 1e-22 XP_016683632.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 1e-22 XP_016649616.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 1e-22 XP_017644896.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 4e-22 XP_012449936.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 4e-22 GAV85020.1 PPR domain-containing protein/PPR_2 domain-containing... 100 9e-22 XP_006467434.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-21 XP_006449728.1 hypothetical protein CICLE_v10014539mg [Citrus cl... 100 1e-21 XP_013641202.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-21 XP_013585776.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-21 XP_009148500.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 6e-21 XP_017979131.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 6e-21 >XP_016171006.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like [Arachis ipaensis] Length = 654 Score = 119 bits (297), Expect = 4e-28 Identities = 60/87 (68%), Positives = 70/87 (80%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 M L+F SSK+ +L AFH K F NP +S DIVFRAICV LKHRRWS LE+LSPK+T+ Sbjct: 1 MILSFFSSKSRNLLARAFHSGKRFLNP-SSGDIVFRAICVNLKHRRWSVLERLSPKLTSS 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQLF 2 +V+RVV EFQNSPQLAL+FYNWVG LF Sbjct: 60 LVSRVVCEFQNSPQLALDFYNWVGGLF 86 >XP_015940619.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like [Arachis duranensis] Length = 648 Score = 114 bits (286), Expect = 1e-26 Identities = 55/81 (67%), Positives = 67/81 (82%) Frame = -2 Query: 244 SSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMVNRVV 65 SSK+C +L AFH K F NP +S DIVF+AICV LKH+RWS LE+LSPK+T+ +V++VV Sbjct: 7 SSKSCNLLARAFHAGKCFLNP-SSGDIVFKAICVNLKHKRWSVLERLSPKLTSSLVSQVV 65 Query: 64 SEFQNSPQLALEFYNWVGQLF 2 EFQNSPQLAL+FYNWVG LF Sbjct: 66 CEFQNSPQLALDFYNWVGGLF 86 >XP_019414190.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Lupinus angustifolius] XP_019414191.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Lupinus angustifolius] OIV99535.1 hypothetical protein TanjilG_17345 [Lupinus angustifolius] Length = 652 Score = 114 bits (284), Expect = 2e-26 Identities = 52/87 (59%), Positives = 70/87 (80%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MF SSK+C++ AFH + FSNP +++DIVF+AICV LKH++W+AL+QL+PK++N Sbjct: 1 MFFRLFSSKSCYLFTRAFHAGERFSNP-SAEDIVFKAICVNLKHKKWNALDQLAPKLSNS 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQLF 2 +VNRVV EFQNSPQLAL+FYN V + F Sbjct: 60 LVNRVVCEFQNSPQLALDFYNRVAEWF 86 >XP_016176352.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like [Arachis ipaensis] Length = 648 Score = 111 bits (278), Expect = 2e-25 Identities = 56/87 (64%), Positives = 69/87 (79%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 M L+F SSK+ +L AFH K F NP +S DIVF+AICV LK +RWS LE+LSPK+T+ Sbjct: 1 MNLSFFSSKSRNLLARAFHAGKRFLNP-SSGDIVFKAICVNLKRKRWSVLERLSPKLTSS 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQLF 2 +V++VV EFQNSPQLAL+FYNWVG LF Sbjct: 60 LVSQVVCEFQNSPQLALDFYNWVGGLF 86 >XP_015960371.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like isoform X2 [Arachis duranensis] Length = 785 Score = 109 bits (272), Expect = 1e-24 Identities = 57/87 (65%), Positives = 69/87 (79%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 M L+F SSK+ +L AFH K F NP S DIVF+AICV LKH+RWS LE+LSPK+T+ Sbjct: 138 MNLSF-SSKSRNLLARAFHAGKRFLNPD-SGDIVFKAICVNLKHKRWSVLERLSPKLTSS 195 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQLF 2 +V++VV EFQNSPQLAL+FYNWVG LF Sbjct: 196 LVSQVVCEFQNSPQLALDFYNWVGGLF 222 >XP_015960370.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like isoform X1 [Arachis duranensis] Length = 803 Score = 109 bits (272), Expect = 1e-24 Identities = 57/87 (65%), Positives = 69/87 (79%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 M L+F SSK+ +L AFH K F NP S DIVF+AICV LKH+RWS LE+LSPK+T+ Sbjct: 156 MNLSF-SSKSRNLLARAFHAGKRFLNPD-SGDIVFKAICVNLKHKRWSVLERLSPKLTSS 213 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQLF 2 +V++VV EFQNSPQLAL+FYNWVG LF Sbjct: 214 LVSQVVCEFQNSPQLALDFYNWVGGLF 240 >OAY31699.1 hypothetical protein MANES_14G133200 [Manihot esculenta] Length = 654 Score = 107 bits (268), Expect = 4e-24 Identities = 51/83 (61%), Positives = 64/83 (77%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MFL+F SK IL FH + F+NP T DIVF+AIC+ LKHRRW+ LEQ+SP +T+ Sbjct: 1 MFLSFWLSKRICILNRGFHACQHFTNPSTG-DIVFKAICINLKHRRWNILEQMSPSLTSL 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWV 14 +V+RV+ +FQNSPQLALEFYNWV Sbjct: 60 LVSRVICQFQNSPQLALEFYNWV 82 >OMO64857.1 hypothetical protein COLO4_31777 [Corchorus olitorius] Length = 656 Score = 103 bits (258), Expect = 8e-23 Identities = 51/82 (62%), Positives = 61/82 (74%) Frame = -2 Query: 253 TFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMVN 74 +F+S + F HV K FS P S+DIVF+AICV LKHRRW LEQ+S +TN +V+ Sbjct: 5 SFLSKRRLFS--RGLHVGKQFSCPKNSEDIVFKAICVNLKHRRWKFLEQVSLSLTNSLVS 62 Query: 73 RVVSEFQNSPQLALEFYNWVGQ 8 RVV EFQNSPQLALEFYNWVG+ Sbjct: 63 RVVREFQNSPQLALEFYNWVGE 84 >OMO76815.1 hypothetical protein CCACVL1_15401 [Corchorus capsularis] Length = 654 Score = 103 bits (257), Expect = 1e-22 Identities = 51/82 (62%), Positives = 60/82 (73%) Frame = -2 Query: 253 TFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMVN 74 +F S + F HV K FS P S+DIVF+AICV LKHRRW LEQ+S +TN +V+ Sbjct: 5 SFFSKRRLFT--RGLHVGKQFSCPKNSEDIVFKAICVNLKHRRWKFLEQVSLSLTNSLVS 62 Query: 73 RVVSEFQNSPQLALEFYNWVGQ 8 RVV EFQNSPQLALEFYNWVG+ Sbjct: 63 RVVREFQNSPQLALEFYNWVGE 84 >XP_016683632.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like [Gossypium hirsutum] Length = 655 Score = 103 bits (257), Expect = 1e-22 Identities = 50/85 (58%), Positives = 64/85 (75%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 +F +F+S ++CF H+ K FS P S+DIVFRAICV LKHRRW L+Q+ P +TN Sbjct: 2 VFCSFLSKRSCFFN-RGLHLGKQFSCP-NSEDIVFRAICVNLKHRRWKFLDQVFPSLTNA 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQ 8 +V+RVV EFQNSPQLALEFY+W G+ Sbjct: 60 LVSRVVGEFQNSPQLALEFYDWFGE 84 >XP_016649616.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X2 [Prunus mume] Length = 169 Score = 97.4 bits (241), Expect = 1e-22 Identities = 46/81 (56%), Positives = 61/81 (75%) Frame = -2 Query: 256 LTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMV 77 L+F KT ++ H+ K FS+P +S++I+FRAICV LK RRW LEQ++P +TN +V Sbjct: 5 LSFSLPKTSHLICRGLHLGKQFSSP-SSENIIFRAICVNLKQRRWKFLEQIAPTLTNSLV 63 Query: 76 NRVVSEFQNSPQLALEFYNWV 14 +RVV EF+NSPQL LEFYNWV Sbjct: 64 SRVVLEFRNSPQLGLEFYNWV 84 >XP_017644896.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Gossypium arboreum] Length = 655 Score = 102 bits (253), Expect = 4e-22 Identities = 50/85 (58%), Positives = 64/85 (75%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 +F +F+S ++CF H+ K FS P S+DIVFRAICV LKHRRW L+Q+ +TN Sbjct: 2 VFCSFLSKRSCFFH-RGLHLGKHFSCP-NSEDIVFRAICVNLKHRRWKFLDQVFSSLTNA 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQ 8 +V+RVV EFQNSPQLALEFY+WVG+ Sbjct: 60 LVSRVVGEFQNSPQLALEFYDWVGE 84 >XP_012449936.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Gossypium raimondii] KJB67197.1 hypothetical protein B456_010G180200 [Gossypium raimondii] Length = 663 Score = 102 bits (253), Expect = 4e-22 Identities = 49/84 (58%), Positives = 63/84 (75%) Frame = -2 Query: 259 FLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFM 80 F +F+S ++CF H+ K FS P S+DIVFRAICV LKHRRW L+Q+ P +TN + Sbjct: 11 FCSFLSKRSCFFN-RGLHLGKQFSCP-NSEDIVFRAICVNLKHRRWKFLDQVFPSLTNAL 68 Query: 79 VNRVVSEFQNSPQLALEFYNWVGQ 8 V+RVV EFQNSP+LALEFY+W G+ Sbjct: 69 VSRVVGEFQNSPELALEFYDWFGE 92 >GAV85020.1 PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 655 Score = 100 bits (250), Expect = 9e-22 Identities = 47/85 (55%), Positives = 60/85 (70%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MF++ SK + FHV K FSNP T +DIVFRA+CV LK R+W LE +SP +TN Sbjct: 1 MFISSFLSKRSYFFSRGFHVGKCFSNPST-EDIVFRAVCVNLKQRKWKFLEDISPSLTNS 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQ 8 +V+RV+ EF+NSP LA EFY WVG+ Sbjct: 60 LVSRVIREFRNSPLLASEFYKWVGE 84 >XP_006467434.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Citrus sinensis] XP_006467435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Citrus sinensis] KDO78230.1 hypothetical protein CISIN_1g006154mg [Citrus sinensis] Length = 658 Score = 100 bits (249), Expect = 1e-21 Identities = 47/72 (65%), Positives = 58/72 (80%) Frame = -2 Query: 223 LIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMVNRVVSEFQNSP 44 L AFHV K F+NP T +DIVFRAICV L+ R+W LEQ++P +TN +VNRVVSEF+ SP Sbjct: 16 LSRAFHVGKQFANPST-EDIVFRAICVNLRQRKWKILEQMAPSLTNSLVNRVVSEFRKSP 74 Query: 43 QLALEFYNWVGQ 8 +LALEFY WVG+ Sbjct: 75 KLALEFYTWVGE 86 >XP_006449728.1 hypothetical protein CICLE_v10014539mg [Citrus clementina] ESR62968.1 hypothetical protein CICLE_v10014539mg [Citrus clementina] Length = 658 Score = 100 bits (249), Expect = 1e-21 Identities = 47/72 (65%), Positives = 58/72 (80%) Frame = -2 Query: 223 LIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNFMVNRVVSEFQNSP 44 L AFHV K F+NP T +DIVFRAICV L+ R+W LEQ++P +TN +VNRVVSEF+ SP Sbjct: 16 LSRAFHVGKQFANPST-EDIVFRAICVNLRQRKWKILEQMAPSLTNSLVNRVVSEFRKSP 74 Query: 43 QLALEFYNWVGQ 8 +LALEFY WVG+ Sbjct: 75 KLALEFYTWVGE 86 >XP_013641202.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like [Brassica napus] Length = 643 Score = 100 bits (248), Expect = 2e-21 Identities = 43/82 (52%), Positives = 63/82 (76%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MF + +T F+++ +FHVAK FSNPP +DI+F ++C+ L+ RRW+AL QLSP +TN Sbjct: 1 MFAQVLFRRTRFLVVRSFHVAKKFSNPPDPEDILFSSLCLNLRQRRWNALHQLSPSLTNP 60 Query: 82 MVNRVVSEFQNSPQLALEFYNW 17 +V RV+ +F+ SP+LALEF+NW Sbjct: 61 LVTRVLLQFRTSPKLALEFHNW 82 >XP_013585776.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Brassica oleracea var. oleracea] Length = 647 Score = 99.8 bits (247), Expect = 2e-21 Identities = 43/82 (52%), Positives = 64/82 (78%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MF I +T F+++ +FHVAK FSNPP +DI+F ++C+ L+ RRW+AL QLSP +TN Sbjct: 1 MFAQVIFRRTRFLVVRSFHVAKKFSNPPDPEDILFSSLCLNLRQRRWNALHQLSPALTNP 60 Query: 82 MVNRVVSEFQNSPQLALEFYNW 17 +V+R++ +F+ SP+LALEF+NW Sbjct: 61 LVSRLLLQFRTSPKLALEFHNW 82 >XP_009148500.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Brassica rapa] Length = 643 Score = 98.6 bits (244), Expect = 6e-21 Identities = 42/82 (51%), Positives = 62/82 (75%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 MF + +T F+++ +FHVAK FSNPP +DI+F ++C+ L+ RRW+AL QLSP +TN Sbjct: 1 MFAQVLFRRTRFLVVRSFHVAKKFSNPPDPEDILFSSLCLNLRQRRWNALHQLSPSLTNP 60 Query: 82 MVNRVVSEFQNSPQLALEFYNW 17 + RV+ +F+ SP+LALEF+NW Sbjct: 61 LATRVLLQFRTSPKLALEFHNW 82 >XP_017979131.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Theobroma cacao] Length = 656 Score = 98.6 bits (244), Expect = 6e-21 Identities = 49/85 (57%), Positives = 62/85 (72%) Frame = -2 Query: 262 MFLTFISSKTCFILIHAFHVAKLFSNPPTSQDIVFRAICVYLKHRRWSALEQLSPKITNF 83 M L+ S+ + HV K FS P +S+DIVFRAICV L+ RRW LEQ+SP +T+ Sbjct: 1 MVLSSFLSRRTSLFSRGLHVGKQFSYP-SSEDIVFRAICVNLRRRRWKFLEQVSPSLTDA 59 Query: 82 MVNRVVSEFQNSPQLALEFYNWVGQ 8 +V+RVV EFQNSPQLALEF+NWVG+ Sbjct: 60 LVSRVVREFQNSPQLALEFHNWVGE 84