BLASTX nr result
ID: Glycyrrhiza34_contig00025590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025590 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014510934.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 92 2e-19 KHN14791.1 hypothetical protein glysoja_020964 [Glycine soja] 92 2e-19 XP_003535384.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 92 2e-19 XP_017410980.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 91 4e-19 XP_012569998.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 91 4e-19 GAU20596.1 hypothetical protein TSUD_33320 [Trifolium subterraneum] 81 1e-15 XP_007154182.1 hypothetical protein PHAVU_003G097100g [Phaseolus... 78 2e-14 XP_003590902.2 hypothetical protein MTR_1g079470 [Medicago trunc... 75 3e-13 KYP74585.1 hypothetical protein KK1_007271 [Cajanus cajan] 69 2e-11 XP_019452875.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 69 2e-11 XP_016197026.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 67 2e-10 XP_010106339.1 hypothetical protein L484_007126 [Morus notabilis... 61 2e-08 XP_010109325.1 hypothetical protein L484_006471 [Morus notabilis... 59 9e-08 KDO42114.1 hypothetical protein CISIN_1g0060532mg [Citrus sinens... 57 3e-07 XP_006479025.1 PREDICTED: U11/U12 small nuclear ribonucleoprotei... 55 9e-07 XP_006443313.1 hypothetical protein CICLE_v10019009mg [Citrus cl... 55 2e-06 >XP_014510934.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Vigna radiata var. radiata] XP_014510935.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Vigna radiata var. radiata] Length = 659 Score = 92.4 bits (228), Expect = 2e-19 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R+RDRWQND HR+HISDSF N FSDRYDPS+S + +D+ISSD KY+K DKFYDKE Sbjct: 601 RSRDRWQNDIHRSHISDSFPNKTFSDRYDPSESLDICDDDISSDAKYIKSDKFYDKE 657 >KHN14791.1 hypothetical protein glysoja_020964 [Glycine soja] Length = 460 Score = 92.0 bits (227), Expect = 2e-19 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R +D WQ DTHR+HISDSF NNAFSDRYDPS+S ED+ISSD KY+K DKFYDKE Sbjct: 402 RIKDGWQKDTHRSHISDSFPNNAFSDRYDPSESLVICEDDISSDSKYIKSDKFYDKE 458 >XP_003535384.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Glycine max] XP_006589217.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Glycine max] XP_014618716.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Glycine max] XP_014618717.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Glycine max] KRH34185.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34186.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34187.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34188.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34189.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34190.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34191.1 hypothetical protein GLYMA_10G169000 [Glycine max] KRH34192.1 hypothetical protein GLYMA_10G169000 [Glycine max] Length = 687 Score = 92.0 bits (227), Expect = 2e-19 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R +D WQ DTHR+HISDSF NNAFSDRYDPS+S ED+ISSD KY+K DKFYDKE Sbjct: 629 RIKDGWQKDTHRSHISDSFPNNAFSDRYDPSESLVICEDDISSDSKYIKSDKFYDKE 685 >XP_017410980.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Vigna angularis] KOM30019.1 hypothetical protein LR48_Vigan845s004700 [Vigna angularis] BAT94908.1 hypothetical protein VIGAN_08155900 [Vigna angularis var. angularis] Length = 658 Score = 91.3 bits (225), Expect = 4e-19 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R+RDRW+NDTHR+HISDSF N FSDRYDPS+S + +D+ISSD KY+K DKFYD E Sbjct: 600 RSRDRWKNDTHRSHISDSFPNKTFSDRYDPSESLDICDDDISSDAKYIKSDKFYDNE 656 >XP_012569998.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Cicer arietinum] XP_012569999.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Cicer arietinum] Length = 658 Score = 91.3 bits (225), Expect = 4e-19 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKELN 169 RT+DRWQNDTH+NHISDSF N FS+RYDPS+ + E +ISSDDKY+K DKFY KE N Sbjct: 600 RTKDRWQNDTHKNHISDSFSRNVFSERYDPSEPHDVGELDISSDDKYIKRDKFYLKERN 658 >GAU20596.1 hypothetical protein TSUD_33320 [Trifolium subterraneum] Length = 398 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKELN 169 RT+DR +NDT +NHISDS N FS+RYDPS+ + E + S DDKY+KPDKFY KELN Sbjct: 340 RTKDRDRNDTRKNHISDSLSRNVFSERYDPSEYHDVREHDSSPDDKYIKPDKFYRKELN 398 >XP_007154182.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] XP_007154183.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] XP_007154184.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] XP_007154185.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] ESW26176.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] ESW26177.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] ESW26178.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] ESW26179.1 hypothetical protein PHAVU_003G097100g [Phaseolus vulgaris] Length = 650 Score = 77.8 bits (190), Expect = 2e-14 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R RDR QNDTHR+HISDSF N FSDRYDPS+S + +D+ +SD KY K D FYDK+ Sbjct: 593 RLRDRRQNDTHRSHISDSFPNKTFSDRYDPSESLDKCDDD-TSDAKYFKSDNFYDKD 648 >XP_003590902.2 hypothetical protein MTR_1g079470 [Medicago truncatula] AES61153.2 hypothetical protein MTR_1g079470 [Medicago truncatula] Length = 643 Score = 74.7 bits (182), Expect = 3e-13 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKF 187 RT+DRWQNDTH+NH SDSF R DPS+SR E +ISSDDKY+KPDKF Sbjct: 597 RTKDRWQNDTHKNHTSDSF------SRSDPSESRGVGEHDISSDDKYIKPDKF 643 >KYP74585.1 hypothetical protein KK1_007271 [Cajanus cajan] Length = 618 Score = 69.3 bits (168), Expect = 2e-11 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYDKE 175 R RDRWQ DTHR+ SDSF NAFSDRY PS+S + ED+I S++K +K DK DKE Sbjct: 561 RIRDRWQKDTHRSRNSDSFPKNAFSDRYHPSESLDICEDDI-SNNKCIKSDKLDDKE 616 >XP_019452875.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Lupinus angustifolius] XP_019452877.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Lupinus angustifolius] XP_019452878.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Lupinus angustifolius] OIW07181.1 hypothetical protein TanjilG_10154 [Lupinus angustifolius] Length = 648 Score = 69.3 bits (168), Expect = 2e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -3 Query: 342 TRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKF 187 T+DR QN++HRN ISDS L NAFSDRY PSDS + +D+ SD K+ KPDKF Sbjct: 593 TKDRQQNNSHRNDISDSVLKNAFSDRYIPSDSHDVRDDDTLSDAKFNKPDKF 644 >XP_016197026.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Arachis ipaensis] Length = 671 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDK 190 R RDRWQ D+ RN++SDS + +AFSDRY PS+S + ED+ISS KY KP++ Sbjct: 618 RARDRWQKDSDRNNVSDSSMKDAFSDRYMPSESLDICEDDISSVAKYTKPER 669 >XP_010106339.1 hypothetical protein L484_007126 [Morus notabilis] EXC10110.1 hypothetical protein L484_007126 [Morus notabilis] Length = 421 Score = 60.8 bits (146), Expect = 2e-08 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFY 184 +++DR D H N S+ F N F DRYDPS S + +ED+IS++ K+++ DKF+ Sbjct: 310 KSKDRRHGDRHENRSSEHFSRNTFEDRYDPSKSHDTYEDDISANSKHIRADKFF 363 >XP_010109325.1 hypothetical protein L484_006471 [Morus notabilis] EXC21757.1 hypothetical protein L484_006471 [Morus notabilis] Length = 763 Score = 58.9 bits (141), Expect = 9e-08 Identities = 26/55 (47%), Positives = 35/55 (63%) Frame = -3 Query: 345 RTRDRWQNDTHRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPDKFYD 181 +++DR D + N S FL N F DRYDPS+S +ED+I ++ KYV DKF D Sbjct: 707 KSKDRHHGDRYENRSSALFLRNTFEDRYDPSESHGTYEDDIPTNSKYVWGDKFVD 761 >KDO42114.1 hypothetical protein CISIN_1g0060532mg [Citrus sinensis] KDO42115.1 hypothetical protein CISIN_1g0060532mg [Citrus sinensis] KDO42116.1 hypothetical protein CISIN_1g0060532mg [Citrus sinensis] Length = 663 Score = 57.4 bits (137), Expect = 3e-07 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -3 Query: 315 HRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPD 193 H++H +DS + NAF DRYDPS+S N ED +SS KY+KP+ Sbjct: 623 HKDHSTDSLVRNAFEDRYDPSESHNRDEDNVSSGGKYIKPE 663 >XP_006479025.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein-like [Citrus sinensis] Length = 210 Score = 55.1 bits (131), Expect = 9e-07 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = -3 Query: 315 HRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPD 193 H +H +DS + NAF DRYDPS+S N ED +S KY+KP+ Sbjct: 170 HNDHSTDSLVRNAFEDRYDPSESHNRDEDNVSDGGKYIKPE 210 >XP_006443313.1 hypothetical protein CICLE_v10019009mg [Citrus clementina] XP_006479024.1 PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Citrus sinensis] ESR56553.1 hypothetical protein CICLE_v10019009mg [Citrus clementina] Length = 738 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = -3 Query: 315 HRNHISDSFLNNAFSDRYDPSDSRNNWEDEISSDDKYVKPD 193 H +H +DS + NAF DRYDPS+S N ED +S KY+KP+ Sbjct: 698 HNDHSTDSLVRNAFEDRYDPSESHNRDEDNVSDGGKYIKPE 738