BLASTX nr result
ID: Glycyrrhiza34_contig00025537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025537 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifo... 54 4e-06 XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 4e-06 >OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifolius] Length = 856 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = +1 Query: 88 NFSTKCGFSTCARQVLVELPEQHVPYWTALIQGFGAWDNGWDG 216 NF KCG + ARQVL E+PEQ V WTALIQGF NG DG Sbjct: 24 NFYAKCGCHSYARQVLDEMPEQDVVSWTALIQGFVGQGNGTDG 66 >XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Lupinus angustifolius] Length = 978 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = +1 Query: 88 NFSTKCGFSTCARQVLVELPEQHVPYWTALIQGFGAWDNGWDG 216 NF KCG + ARQVL E+PEQ V WTALIQGF NG DG Sbjct: 146 NFYAKCGCHSYARQVLDEMPEQDVVSWTALIQGFVGQGNGTDG 188