BLASTX nr result
ID: Glycyrrhiza34_contig00024998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024998 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF45953.1 conserved hypothetical protein [Ricinus communis] 70 2e-14 GAU41968.1 hypothetical protein TSUD_306740 [Trifolium subterran... 75 3e-14 XP_003603470.1 DnaJ heat shock family protein [Medicago truncatu... 75 3e-14 XP_007137077.1 hypothetical protein PHAVU_009G097800g [Phaseolus... 75 3e-14 KRH61858.1 hypothetical protein GLYMA_04G0720001, partial [Glyci... 71 6e-14 XP_017644105.1 PREDICTED: dnaJ homolog subfamily B member 4-like... 74 7e-14 XP_016682872.1 PREDICTED: dnaJ homolog subfamily B member 4-like... 74 7e-14 XP_012450928.1 PREDICTED: dnaJ homolog subfamily B member 4-like... 74 7e-14 BAT78219.1 hypothetical protein VIGAN_02087000 [Vigna angularis ... 74 7e-14 BAC41957.1 putative heat shock protein [Arabidopsis thaliana] 69 9e-14 XP_016169530.1 PREDICTED: dnaJ homolog subfamily B member 4 [Ara... 73 2e-13 XP_015937178.1 PREDICTED: dnaJ homolog subfamily B member 4 [Ara... 73 2e-13 KYP34092.1 DnaJ isogeny subfamily B member 4 [Cajanus cajan] 73 2e-13 XP_008219853.1 PREDICTED: dnaJ homolog subfamily B member 1 [Pru... 73 2e-13 XP_007224208.1 hypothetical protein PRUPE_ppa017410mg [Prunus pe... 73 2e-13 XP_009117486.1 PREDICTED: dnaJ homolog subfamily B member 13 [Br... 73 2e-13 XP_013664272.1 PREDICTED: dnaJ homolog subfamily B member 13-lik... 73 2e-13 XP_006289060.1 hypothetical protein CARUB_v10002457mg [Capsella ... 73 2e-13 XP_002961542.1 hypothetical protein SELMODRAFT_230025 [Selaginel... 72 2e-13 OAY26699.1 hypothetical protein MANES_16G068100 [Manihot esculenta] 73 2e-13 >EEF45953.1 conserved hypothetical protein [Ricinus communis] Length = 61 Score = 70.5 bits (171), Expect = 2e-14 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+LKV+RNAT+DDLKK+YR+LAMKWHPD Sbjct: 1 MGVDYYNVLKVNRNATDDDLKKSYRRLAMKWHPD 34 >GAU41968.1 hypothetical protein TSUD_306740 [Trifolium subterraneum] Length = 327 Score = 75.1 bits (183), Expect = 3e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYNILKVD+NATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNILKVDKNATEDDLKKAYRKLAMKWHPD 34 >XP_003603470.1 DnaJ heat shock family protein [Medicago truncatula] AES73721.1 DnaJ heat shock family protein [Medicago truncatula] Length = 327 Score = 75.1 bits (183), Expect = 3e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYNILKVD+NATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNILKVDKNATEDDLKKAYRKLAMKWHPD 34 >XP_007137077.1 hypothetical protein PHAVU_009G097800g [Phaseolus vulgaris] ESW09071.1 hypothetical protein PHAVU_009G097800g [Phaseolus vulgaris] Length = 333 Score = 75.1 bits (183), Expect = 3e-14 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = -3 Query: 114 EEKKMGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 E+++MGVDYY++LKV+RNATEDDLKKAYRKLAMKWHPD Sbjct: 2 EKEEMGVDYYDVLKVNRNATEDDLKKAYRKLAMKWHPD 39 >KRH61858.1 hypothetical protein GLYMA_04G0720001, partial [Glycine max] Length = 142 Score = 71.2 bits (173), Expect = 6e-14 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MG+DYYN+LKV+RNA+EDDLKKAYRKLAMKWHPD Sbjct: 1 MGLDYYNVLKVNRNASEDDLKKAYRKLAMKWHPD 34 >XP_017644105.1 PREDICTED: dnaJ homolog subfamily B member 4-like [Gossypium arboreum] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+L+VDRNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNVLQVDRNATEDDLKKAYRKLAMKWHPD 34 >XP_016682872.1 PREDICTED: dnaJ homolog subfamily B member 4-like [Gossypium hirsutum] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+L+VDRNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNVLQVDRNATEDDLKKAYRKLAMKWHPD 34 >XP_012450928.1 PREDICTED: dnaJ homolog subfamily B member 4-like [Gossypium raimondii] KJB64542.1 hypothetical protein B456_010G053400 [Gossypium raimondii] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+L+VDRNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNVLQVDRNATEDDLKKAYRKLAMKWHPD 34 >BAT78219.1 hypothetical protein VIGAN_02087000 [Vigna angularis var. angularis] Length = 350 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -3 Query: 123 FLFEEKKMGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 F E++ MGVDYY++LKV+RNATEDD+KK+YRKLAMKWHPD Sbjct: 16 FFVEKENMGVDYYDVLKVNRNATEDDVKKSYRKLAMKWHPD 56 >BAC41957.1 putative heat shock protein [Arabidopsis thaliana] Length = 57 Score = 68.6 bits (166), Expect = 9e-14 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYY +L+VDRNA +DDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPD 34 >XP_016169530.1 PREDICTED: dnaJ homolog subfamily B member 4 [Arachis ipaensis] Length = 315 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYY+ILKV+RNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYSILKVERNATEDDLKKAYRKLAMKWHPD 34 >XP_015937178.1 PREDICTED: dnaJ homolog subfamily B member 4 [Arachis duranensis] Length = 315 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYY+ILKV+RNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYSILKVERNATEDDLKKAYRKLAMKWHPD 34 >KYP34092.1 DnaJ isogeny subfamily B member 4 [Cajanus cajan] Length = 324 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MG+DYYN+LKV+RNATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGLDYYNVLKVNRNATEDDLKKAYRKLAMKWHPD 34 >XP_008219853.1 PREDICTED: dnaJ homolog subfamily B member 1 [Prunus mume] Length = 334 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+LKV+RNATEDDLKKAYR+LAMKWHPD Sbjct: 1 MGVDYYNVLKVNRNATEDDLKKAYRRLAMKWHPD 34 >XP_007224208.1 hypothetical protein PRUPE_ppa017410mg [Prunus persica] ONI34180.1 hypothetical protein PRUPE_1G466900 [Prunus persica] Length = 334 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+LKV+RNATEDDLKKAYR+LAMKWHPD Sbjct: 1 MGVDYYNVLKVNRNATEDDLKKAYRRLAMKWHPD 34 >XP_009117486.1 PREDICTED: dnaJ homolog subfamily B member 13 [Brassica rapa] Length = 338 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+L+VDRNA+EDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNVLQVDRNASEDDLKKAYRKLAMKWHPD 34 >XP_013664272.1 PREDICTED: dnaJ homolog subfamily B member 13-like [Brassica napus] CDY13869.1 BnaA09g43710D [Brassica napus] Length = 338 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYN+L+VDRNA+EDDLKKAYRKLAMKWHPD Sbjct: 1 MGVDYYNVLQVDRNASEDDLKKAYRKLAMKWHPD 34 >XP_006289060.1 hypothetical protein CARUB_v10002457mg [Capsella rubella] EOA21958.1 hypothetical protein CARUB_v10002457mg [Capsella rubella] Length = 339 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MG+DYYNILKVDRNATEDDLKK+YR+LAMKWHPD Sbjct: 1 MGLDYYNILKVDRNATEDDLKKSYRRLAMKWHPD 34 >XP_002961542.1 hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii] EFJ36802.1 hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii] Length = 294 Score = 72.4 bits (176), Expect = 2e-13 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MG+DYY++LKVD+NATEDDLKKAYRKLAMKWHPD Sbjct: 1 MGIDYYSVLKVDKNATEDDLKKAYRKLAMKWHPD 34 >OAY26699.1 hypothetical protein MANES_16G068100 [Manihot esculenta] Length = 343 Score = 72.8 bits (177), Expect = 2e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 102 MGVDYYNILKVDRNATEDDLKKAYRKLAMKWHPD 1 MGVDYYNILKVD+NAT+DDLKK+YRKLAMKWHPD Sbjct: 1 MGVDYYNILKVDKNATDDDLKKSYRKLAMKWHPD 34