BLASTX nr result
ID: Glycyrrhiza34_contig00024975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024975 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36121.1 hypothetical protein TSUD_374840 [Trifolium subterran... 62 3e-09 XP_007135104.1 hypothetical protein PHAVU_010G101400g [Phaseolus... 52 9e-06 >GAU36121.1 hypothetical protein TSUD_374840 [Trifolium subterraneum] Length = 630 Score = 62.4 bits (150), Expect = 3e-09 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = +1 Query: 1 VMANSRLTKKKQDWKAN--DFEDLSSDDDWIVEN-DQNSDLDLDAPSEDILVPVGEEDDS 171 VM NSRL KKKQ K D +DL+SDD+W+ +N D+NSD DLDAP E VGEED + Sbjct: 530 VMVNSRLDKKKQARKGKVYDIDDLASDDEWVADNVDENSDFDLDAPIE-----VGEEDAN 584 Query: 172 GSCG 183 S G Sbjct: 585 VSIG 588 >XP_007135104.1 hypothetical protein PHAVU_010G101400g [Phaseolus vulgaris] ESW07098.1 hypothetical protein PHAVU_010G101400g [Phaseolus vulgaris] Length = 240 Score = 52.0 bits (123), Expect = 9e-06 Identities = 26/58 (44%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = +1 Query: 1 VMANSRLTKKKQDWKAND--FEDLSSDDDWIVENDQNSDLDLDAPSEDILVPVGEEDD 168 VMANSRL KKK K D F+DL+S+D+W +E+++ +D++ P D+ VP+ E+D+ Sbjct: 156 VMANSRLMKKKDVRKTKDYNFDDLASNDEWTMEDNEANDIE---PMGDLEVPIAEDDE 210