BLASTX nr result
ID: Glycyrrhiza34_contig00024773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024773 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013445434.1 PPR repeat protein [Medicago truncatula] KEH19460... 59 2e-09 XP_013445433.1 PPR repeat protein [Medicago truncatula] KEH19459... 59 3e-09 XP_012575444.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 9e-09 XP_019465046.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 4e-08 KHN46681.1 Putative pentatricopeptide repeat-containing protein ... 55 8e-07 XP_003525968.1 PREDICTED: putative pentatricopeptide repeat-cont... 55 1e-06 KYP56671.1 Putative pentatricopeptide repeat-containing protein ... 52 6e-06 >XP_013445434.1 PPR repeat protein [Medicago truncatula] KEH19460.1 PPR repeat protein [Medicago truncatula] Length = 110 Score = 59.3 bits (142), Expect = 2e-09 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 261 TVLSGLVSRGNYSCNEDVWNVVVSMVCKPEKL-PEPFEIFDALVLA 127 TVLSGL SRG + CNE +WNV+VS+VCK EKL EPF+IF AL ++ Sbjct: 66 TVLSGLASRGEF-CNEGIWNVLVSVVCKQEKLAAEPFKIFKALAVS 110 >XP_013445433.1 PPR repeat protein [Medicago truncatula] KEH19459.1 PPR repeat protein [Medicago truncatula] Length = 134 Score = 59.3 bits (142), Expect = 3e-09 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 261 TVLSGLVSRGNYSCNEDVWNVVVSMVCKPEKL-PEPFEIFDALVLA 127 TVLSGL SRG + CNE +WNV+VS+VCK EKL EPF+IF AL ++ Sbjct: 90 TVLSGLASRGEF-CNEGIWNVLVSVVCKQEKLAAEPFKIFKALAVS 134 >XP_012575444.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Cicer arietinum] Length = 458 Score = 60.5 bits (145), Expect = 9e-09 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -2 Query: 261 TVLSGLVSRGNYSCNEDVWNVVVSMVCKPEKL-PEPFEIFDALV 133 TVLSGLVSRG++ CN +WNV+V MVC+PEKL +PFEIFD LV Sbjct: 415 TVLSGLVSRGDF-CNGSLWNVLVPMVCEPEKLAAKPFEIFDDLV 457 >XP_019465046.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Lupinus angustifolius] OIV99016.1 hypothetical protein TanjilG_32275 [Lupinus angustifolius] Length = 483 Score = 58.5 bits (140), Expect = 4e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 261 TVLSGLVSRGNYSCNEDVWNVVVSMVCKPEKLPEPFEIFDALVL 130 TVLSGL RGN+ +ED+W +VVS VCKPEKL EPFEI D LV+ Sbjct: 442 TVLSGL-GRGNF-LHEDIWEIVVSRVCKPEKLLEPFEILDTLVV 483 >KHN46681.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 285 Score = 54.7 bits (130), Expect = 8e-07 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 258 VLSGLVSRGNYSCNEDVWNVVVSMVCKPEKLPEPFEIFDALVLA 127 VLSGL G + CNE+VW VVS+VCK EKL FE+ DALVLA Sbjct: 244 VLSGL--GGGFFCNENVWKTVVSLVCKSEKLSGAFELLDALVLA 285 >XP_003525968.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Glycine max] XP_006582122.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Glycine max] XP_014632167.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Glycine max] KRH55064.1 hypothetical protein GLYMA_06G227700 [Glycine max] Length = 465 Score = 54.7 bits (130), Expect = 1e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 258 VLSGLVSRGNYSCNEDVWNVVVSMVCKPEKLPEPFEIFDALVLA 127 VLSGL G + CNE+VW VVS+VCK EKL FE+ DALVLA Sbjct: 424 VLSGL--GGGFFCNENVWKTVVSLVCKSEKLSGAFELLDALVLA 465 >KYP56671.1 Putative pentatricopeptide repeat-containing protein At1g53330 family [Cajanus cajan] Length = 459 Score = 52.4 bits (124), Expect = 6e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -2 Query: 258 VLSGLVSRGNYSCNEDVWNVVVSMVCKPEKLPEPFEIFDALVL 130 VLSGL G C+EDVW VVS+VCK EK+ FE+FDALVL Sbjct: 418 VLSGLGREG--FCSEDVWRTVVSLVCKSEKMLGAFEVFDALVL 458