BLASTX nr result
ID: Glycyrrhiza34_contig00024613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024613 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007153205.1 hypothetical protein PHAVU_003G015800g [Phaseolus... 52 7e-06 >XP_007153205.1 hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris] ESW25199.1 hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris] Length = 929 Score = 51.6 bits (122), Expect = 7e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -2 Query: 184 RKHKRAGKAPSPNVVVVHPRHSGDGNGVKI 95 RK KRAGK SP+ +V+HPR+SGDGNG+KI Sbjct: 497 RKRKRAGKVQSPSAIVIHPRYSGDGNGLKI 526