BLASTX nr result
ID: Glycyrrhiza34_contig00024513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024513 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, ... 67 2e-11 XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [M... 67 2e-11 XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 2e-11 KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimo... 66 2e-11 KDP27226.1 hypothetical protein JCGZ_19925 [Jatropha curcas] 67 3e-11 OAY60239.1 hypothetical protein MANES_01G097500 [Manihot esculenta] 67 3e-11 KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimo... 66 3e-11 KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimo... 66 4e-11 XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 4e-11 XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 4e-11 NP_001241523.1 uncharacterized protein LOC100777962 [Glycine max... 67 4e-11 XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of ace... 67 4e-11 EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACC... 67 5e-11 XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of ace... 66 6e-11 AFS89700.1 biotin carboxyl carrier protein [Vernicia fordii] 66 6e-11 AFP99173.1 biotin carboxyl carrier protein [Vernicia fordii] 66 8e-11 NP_001295674.1 biotin carboxyl carrier protein of acetyl-CoA car... 66 8e-11 XP_008379410.1 PREDICTED: biotin carboxyl carrier protein of ace... 66 8e-11 XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of ace... 66 9e-11 KJB75634.1 hypothetical protein B456_012G049400 [Gossypium raimo... 66 9e-11 >KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, chloroplastic -like protein [Gossypium arboreum] Length = 270 Score = 67.4 bits (163), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGKSV+VDMPLFVIVP Sbjct: 235 KLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 270 >XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] AES74934.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 67.4 bits (163), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAEILVEDGK V+VD+PLFVIVP Sbjct: 243 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIVP 278 >XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium arboreum] Length = 284 Score = 67.4 bits (163), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGKSV+VDMPLFVIVP Sbjct: 249 KLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 284 >KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimondii] KJB33438.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 201 Score = 66.2 bits (160), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 166 KLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 201 >KDP27226.1 hypothetical protein JCGZ_19925 [Jatropha curcas] Length = 270 Score = 67.0 bits (162), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAEILVEDGK V+VDMPLFVI P Sbjct: 235 KLMNEIEADQSGTIAEILVEDGKPVSVDMPLFVIAP 270 >OAY60239.1 hypothetical protein MANES_01G097500 [Manihot esculenta] Length = 271 Score = 67.0 bits (162), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAEILVEDGK V+VDMPLFVI P Sbjct: 236 KLMNEIEADQSGTIAEILVEDGKPVSVDMPLFVIAP 271 >KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 226 Score = 66.2 bits (160), Expect = 3e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 191 KLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 226 >KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 233 Score = 66.2 bits (160), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 198 KLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 233 >XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X2 [Ziziphus jujuba] Length = 267 Score = 66.6 bits (161), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGT+ EILVEDGK V+VDMPLFVIVP Sbjct: 232 KLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 267 >XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Theobroma cacao] EOY09754.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 66.6 bits (161), Expect = 4e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EILVEDGKSV+VDMPLFVI P Sbjct: 244 KLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >NP_001241523.1 uncharacterized protein LOC100777962 [Glycine max] ACU23332.1 unknown [Glycine max] KRG93630.1 hypothetical protein GLYMA_19G028800 [Glycine max] Length = 280 Score = 66.6 bits (161), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAE+L EDGK V+VDMPLFVIVP Sbjct: 245 KLMNEIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP 280 >XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X1 [Ziziphus jujuba] Length = 282 Score = 66.6 bits (161), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGT+ EILVEDGK V+VDMPLFVIVP Sbjct: 247 KLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 282 >EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 66.6 bits (161), Expect = 5e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EILVEDGKSV+VDMPLFVI P Sbjct: 275 KLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium raimondii] KJB33440.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 284 Score = 66.2 bits (160), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 249 KLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 284 >AFS89700.1 biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 65.9 bits (159), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAEILVEDGK V+VD+PLFVI P Sbjct: 217 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 252 >AFP99173.1 biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 65.9 bits (159), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGTIAEILVEDGK V+VD+PLFVI P Sbjct: 235 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 270 >NP_001295674.1 biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Jatropha curcas] ACT33948.1 biotin carboxyl carrier protein subunit [Jatropha curcas] Length = 270 Score = 65.9 bits (159), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQ+GTIAEILVEDGK V+VDMPLFVI P Sbjct: 235 KLMNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 >XP_008379410.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Malus domestica] Length = 278 Score = 65.9 bits (159), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 109 KLMNEIEADQSGT+AEILVEDGK V+VD PLFVIVP Sbjct: 243 KLMNEIEADQSGTVAEILVEDGKPVSVDTPLFVIVP 278 >XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium raimondii] KJB75633.1 hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 290 Score = 65.9 bits (159), Expect = 9e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIV 106 KLMNEIEADQSGT+ EILVEDGKSV+VDMPLFVIV Sbjct: 255 KLMNEIEADQSGTVTEILVEDGKSVSVDMPLFVIV 289 >KJB75634.1 hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 291 Score = 65.9 bits (159), Expect = 9e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 2 KLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIV 106 KLMNEIEADQSGT+ EILVEDGKSV+VDMPLFVIV Sbjct: 256 KLMNEIEADQSGTVTEILVEDGKSVSVDMPLFVIV 290