BLASTX nr result
ID: Glycyrrhiza34_contig00023652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023652 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013458236.1 hypothetical protein MTR_4g118657 [Medicago trunc... 59 1e-08 >XP_013458236.1 hypothetical protein MTR_4g118657 [Medicago truncatula] KEH32267.1 hypothetical protein MTR_4g118657 [Medicago truncatula] Length = 89 Score = 58.5 bits (140), Expect = 1e-08 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Frame = +2 Query: 131 KLSLPLVIRNPMLIYSHCNWD*NGSETKPRMQPKNRHNH--LPSRGSRRNNTKMSHRAVK 304 KLS+P+++ +P+L YS NWD N E KPRMQP+ PSR RNNTKM HRA+ Sbjct: 27 KLSVPVLVYSPILDYSQYNWDSNELEPKPRMQPRTGTTMPIFPSRAG-RNNTKMLHRAII 85 Query: 305 S 307 S Sbjct: 86 S 86