BLASTX nr result
ID: Glycyrrhiza34_contig00023628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023628 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019464916.1 PREDICTED: probable BOI-related E3 ubiquitin-prot... 51 9e-06 >XP_019464916.1 PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Lupinus angustifolius] OIV99046.1 hypothetical protein TanjilG_32305 [Lupinus angustifolius] Length = 342 Score = 51.2 bits (121), Expect = 9e-06 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = -2 Query: 218 NNNNNVPVSRKRSRETINNNYDPFPSHKNCGT-LSFLGXXXXXXXXXXXXXXDNLISQHM 42 NNNNNVPVSRKRS ++IN + P HKN T LSFLG DNL+SQHM Sbjct: 91 NNNNNVPVSRKRSIDSINYS---LPYHKNRATNLSFLGEDMSLQIHHQQLDLDNLVSQHM 147