BLASTX nr result
ID: Glycyrrhiza34_contig00023405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023405 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW10288.1 hypothetical protein TanjilG_28039 [Lupinus angustifo... 64 2e-09 XP_019445940.1 PREDICTED: myb family transcription factor PHL8-l... 64 2e-09 XP_019445939.1 PREDICTED: myb family transcription factor PHL8-l... 64 2e-09 XP_014506890.1 PREDICTED: uncharacterized protein LOC106766690 [... 64 2e-09 OIW21894.1 hypothetical protein TanjilG_13841 [Lupinus angustifo... 61 3e-09 XP_007158649.1 hypothetical protein PHAVU_002G170700g [Phaseolus... 63 5e-09 XP_019434082.1 PREDICTED: myb family transcription factor PHL8-l... 61 2e-08 XP_004505417.1 PREDICTED: protein PHR1-LIKE 1-like [Cicer arieti... 61 2e-08 XP_017424791.1 PREDICTED: myb family transcription factor PHL8-l... 61 2e-08 KHN28253.1 Myb family transcription factor APL [Glycine soja] 60 3e-08 XP_003556805.1 PREDICTED: uncharacterized protein LOC100805252 [... 60 3e-08 XP_017427546.1 PREDICTED: myb family transcription factor PHL8-l... 60 3e-08 XP_014520124.1 PREDICTED: uncharacterized protein LOC106777111 [... 60 3e-08 XP_017427545.1 PREDICTED: myb family transcription factor PHL8-l... 60 3e-08 XP_007157612.1 hypothetical protein PHAVU_002G084100g [Phaseolus... 60 3e-08 KYP45421.1 Myb family transcription factor APL [Cajanus cajan] 60 3e-08 XP_003529477.1 PREDICTED: uncharacterized protein LOC100776601 [... 59 2e-07 ACU23397.1 unknown [Glycine max] 59 2e-07 XP_004297295.1 PREDICTED: uncharacterized protein LOC101303116 i... 58 2e-07 XP_011463063.1 PREDICTED: uncharacterized protein LOC101303116 i... 58 2e-07 >OIW10288.1 hypothetical protein TanjilG_28039 [Lupinus angustifolius] Length = 291 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNVQNQS+RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQSLRLVLSTDAKPRLKWTPELH 30 >XP_019445940.1 PREDICTED: myb family transcription factor PHL8-like isoform X2 [Lupinus angustifolius] Length = 334 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNVQNQS+RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQSLRLVLSTDAKPRLKWTPELH 30 >XP_019445939.1 PREDICTED: myb family transcription factor PHL8-like isoform X1 [Lupinus angustifolius] Length = 335 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNVQNQS+RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQSLRLVLSTDAKPRLKWTPELH 30 >XP_014506890.1 PREDICTED: uncharacterized protein LOC106766690 [Vigna radiata var. radiata] Length = 341 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNVQNQ+MRLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQNMRLVLSTDAKPRLKWTPELH 30 >OIW21894.1 hypothetical protein TanjilG_13841 [Lupinus angustifolius] Length = 159 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDL+NVQNQSMRLVLSTD KPR+KWTPELH Sbjct: 1 MDLKNVQNQSMRLVLSTDTKPRMKWTPELH 30 >XP_007158649.1 hypothetical protein PHAVU_002G170700g [Phaseolus vulgaris] ESW30643.1 hypothetical protein PHAVU_002G170700g [Phaseolus vulgaris] Length = 341 Score = 62.8 bits (151), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNVQ QSMRLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQTQSMRLVLSTDAKPRLKWTPELH 30 >XP_019434082.1 PREDICTED: myb family transcription factor PHL8-like [Lupinus angustifolius] Length = 313 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDL+NVQNQSMRLVLSTD KPR+KWTPELH Sbjct: 1 MDLKNVQNQSMRLVLSTDTKPRMKWTPELH 30 >XP_004505417.1 PREDICTED: protein PHR1-LIKE 1-like [Cicer arietinum] Length = 332 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MD +NVQNQSMRLVLSTDAKPRLKWTPELH Sbjct: 1 MDQKNVQNQSMRLVLSTDAKPRLKWTPELH 30 >XP_017424791.1 PREDICTED: myb family transcription factor PHL8-like [Vigna angularis] BAT74501.1 hypothetical protein VIGAN_01218600 [Vigna angularis var. angularis] Length = 341 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQNV+N++MRLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVENRTMRLVLSTDAKPRLKWTPELH 30 >KHN28253.1 Myb family transcription factor APL [Glycine soja] Length = 334 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 MDLQNVQNQSM-RLVLSTDAKPRLKWTPELH 1 MDLQNVQNQSM RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQSMMRLVLSTDAKPRLKWTPELH 31 >XP_003556805.1 PREDICTED: uncharacterized protein LOC100805252 [Glycine max] KRG89622.1 hypothetical protein GLYMA_20G035300 [Glycine max] Length = 334 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 MDLQNVQNQSM-RLVLSTDAKPRLKWTPELH 1 MDLQNVQNQSM RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNQSMMRLVLSTDAKPRLKWTPELH 31 >XP_017427546.1 PREDICTED: myb family transcription factor PHL8-like isoform X2 [Vigna angularis] Length = 343 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQN+QNQSM VLSTDAKPRLKWTPELH Sbjct: 1 MDLQNMQNQSMHFVLSTDAKPRLKWTPELH 30 >XP_014520124.1 PREDICTED: uncharacterized protein LOC106777111 [Vigna radiata var. radiata] Length = 344 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQN+QNQSM VLSTDAKPRLKWTPELH Sbjct: 1 MDLQNMQNQSMHFVLSTDAKPRLKWTPELH 30 >XP_017427545.1 PREDICTED: myb family transcription factor PHL8-like isoform X1 [Vigna angularis] KOM45768.1 hypothetical protein LR48_Vigan06g107400 [Vigna angularis] BAT99230.1 hypothetical protein VIGAN_10063100 [Vigna angularis var. angularis] Length = 344 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQN+QNQSM VLSTDAKPRLKWTPELH Sbjct: 1 MDLQNMQNQSMHFVLSTDAKPRLKWTPELH 30 >XP_007157612.1 hypothetical protein PHAVU_002G084100g [Phaseolus vulgaris] ESW29606.1 hypothetical protein PHAVU_002G084100g [Phaseolus vulgaris] Length = 344 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQN+QNQSM VLSTDAKPRLKWTPELH Sbjct: 1 MDLQNMQNQSMHFVLSTDAKPRLKWTPELH 30 >KYP45421.1 Myb family transcription factor APL [Cajanus cajan] Length = 345 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 MDLQN+QNQSM VLSTDAKPRLKWTPELH Sbjct: 1 MDLQNMQNQSMHFVLSTDAKPRLKWTPELH 30 >XP_003529477.1 PREDICTED: uncharacterized protein LOC100776601 [Glycine max] KRH50579.1 hypothetical protein GLYMA_07G229800 [Glycine max] Length = 331 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 90 MDLQNVQNQSM-RLVLSTDAKPRLKWTPELH 1 MDLQNVQN SM RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNHSMMRLVLSTDAKPRLKWTPELH 31 >ACU23397.1 unknown [Glycine max] Length = 331 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 90 MDLQNVQNQSM-RLVLSTDAKPRLKWTPELH 1 MDLQNVQN SM RLVLSTDAKPRLKWTPELH Sbjct: 1 MDLQNVQNHSMMRLVLSTDAKPRLKWTPELH 31 >XP_004297295.1 PREDICTED: uncharacterized protein LOC101303116 isoform X2 [Fragaria vesca subsp. vesca] Length = 333 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 M LQN+QNQ+M LVLSTDAKPRLKWTPELH Sbjct: 1 MGLQNMQNQNMNLVLSTDAKPRLKWTPELH 30 >XP_011463063.1 PREDICTED: uncharacterized protein LOC101303116 isoform X1 [Fragaria vesca subsp. vesca] Length = 336 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MDLQNVQNQSMRLVLSTDAKPRLKWTPELH 1 M LQN+QNQ+M LVLSTDAKPRLKWTPELH Sbjct: 1 MGLQNMQNQNMNLVLSTDAKPRLKWTPELH 30