BLASTX nr result
ID: Glycyrrhiza34_contig00023392
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023392 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013448812.1 Dof domain zinc finger protein [Medicago truncatu... 62 1e-08 XP_004515618.1 PREDICTED: dof zinc finger protein DOF2.4-like [C... 60 5e-08 XP_016198319.1 PREDICTED: dof zinc finger protein DOF2.4-like [A... 54 6e-06 XP_015960388.1 PREDICTED: dof zinc finger protein DOF2.4-like [A... 54 6e-06 >XP_013448812.1 Dof domain zinc finger protein [Medicago truncatula] KEH22839.1 Dof domain zinc finger protein [Medicago truncatula] Length = 348 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 258 MVYTSLPSYMDPANWHQQQPNHQVANT 338 MVYTSLP YMDPANWHQQQPNHQVANT Sbjct: 1 MVYTSLPPYMDPANWHQQQPNHQVANT 27 >XP_004515618.1 PREDICTED: dof zinc finger protein DOF2.4-like [Cicer arietinum] Length = 349 Score = 60.1 bits (144), Expect = 5e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 258 MVYTSLPSYMDPANWHQQQPNHQVAN 335 MVYTSLP YMDPANWHQQQPNHQVAN Sbjct: 1 MVYTSLPPYMDPANWHQQQPNHQVAN 26 >XP_016198319.1 PREDICTED: dof zinc finger protein DOF2.4-like [Arachis ipaensis] Length = 351 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +3 Query: 258 MVYTSLPSYMDPANWH-QQQPNHQVANTGG 344 MVYTS+P+Y+DP NWH QQQPNHQ NTGG Sbjct: 1 MVYTSIPAYIDPVNWHEQQQPNHQQNNTGG 30 >XP_015960388.1 PREDICTED: dof zinc finger protein DOF2.4-like [Arachis duranensis] Length = 354 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +3 Query: 258 MVYTSLPSYMDPANWH-QQQPNHQVANTGG 344 MVYTS+P+Y+DP NWH QQQPNHQ NTGG Sbjct: 1 MVYTSIPAYIDPVNWHQQQQPNHQQNNTGG 30