BLASTX nr result
ID: Glycyrrhiza34_contig00023359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023359 (717 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003531359.1 PREDICTED: ethylene-responsive transcription fact... 57 7e-06 ADD09598.1 dehydration responsive element binding protein [Trifo... 56 9e-06 >XP_003531359.1 PREDICTED: ethylene-responsive transcription factor ERF060 [Glycine max] AAQ57226.1 DREB2 [Glycine max] KRH43212.1 hypothetical protein GLYMA_08G137600 [Glycine max] KRH43213.1 hypothetical protein GLYMA_08G137600 [Glycine max] Length = 312 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 447 MATAIDIYNSSSNMNIITPDFLDPYSEELMKALKPFMK 560 M TAID+YNSS+ I DFLDPYSEELMKALKPFMK Sbjct: 1 MGTAIDMYNSSN----IVADFLDPYSEELMKALKPFMK 34 >ADD09598.1 dehydration responsive element binding protein [Trifolium repens] Length = 304 Score = 56.2 bits (134), Expect = 9e-06 Identities = 38/90 (42%), Positives = 45/90 (50%) Frame = +3 Query: 447 MATAIDIYNSSSNMNIITPDFLDPYSEELMKALKPFMKXXXXXXXXXXXXXXXXXXXXXX 626 M+TAI+IYNS+ N IT FLDP++EELMKAL+PF+K Sbjct: 1 MSTAINIYNSNKN---ITHGFLDPFNEELMKALEPFIKSDYSTISSSTHEQSDFPSTSYS 57 Query: 627 XXXXXXXXXXXXNHMGRTQTSSIGLNQLTP 716 TQTSSIGLNQLTP Sbjct: 58 PFSPNYFTY-------ETQTSSIGLNQLTP 80