BLASTX nr result
ID: Glycyrrhiza34_contig00023309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00023309 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH50348.1 hypothetical protein GLYMA_07G216300, partial [Glycin... 191 1e-57 KHN43040.1 Putative pentatricopeptide repeat-containing protein ... 191 5e-56 XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 2e-54 XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus... 190 2e-54 XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 3e-54 XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 3e-54 KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angul... 188 1e-53 XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing pr... 188 1e-53 XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing pr... 187 3e-53 XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago ... 186 6e-53 XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing pr... 183 8e-52 KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine ... 181 1e-51 XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing pr... 181 3e-51 XP_018845279.1 PREDICTED: pentatricopeptide repeat-containing pr... 177 1e-49 XP_015873004.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 6e-45 XP_002271063.1 PREDICTED: pentatricopeptide repeat-containing pr... 161 5e-44 XP_017976251.1 PREDICTED: pentatricopeptide repeat-containing pr... 161 5e-44 EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobro... 161 7e-44 XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 6e-43 XP_015868900.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 6e-43 >KRH50348.1 hypothetical protein GLYMA_07G216300, partial [Glycine max] Length = 374 Score = 191 bits (484), Expect = 1e-57 Identities = 92/107 (85%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 G++ GH ALGVY RMIEERL PNQTTFVSLLTACSHSGLVEEGK LFHCMERDHNIKP Sbjct: 73 GIYAHGHYALGVYGRMIEERLNPNQTTFVSLLTACSHSGLVEEGKALFHCMERDHNIKPQ 132 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG LEEADALVKQMPF+PS DVLEALLSGCRT + Sbjct: 133 DKHYACLVDLLSRAGRLEEADALVKQMPFQPSTDVLEALLSGCRTHK 179 >KHN43040.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 554 Score = 191 bits (484), Expect = 5e-56 Identities = 92/107 (85%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 G++ GH ALGVY RMIEERL PNQTTFVSLLTACSHSGLVEEGK LFHCMERDHNIKP Sbjct: 253 GIYAHGHYALGVYGRMIEERLNPNQTTFVSLLTACSHSGLVEEGKALFHCMERDHNIKPQ 312 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG LEEADALVKQMPF+PS DVLEALLSGCRT + Sbjct: 313 DKHYACLVDLLSRAGRLEEADALVKQMPFQPSTDVLEALLSGCRTHK 359 >XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cicer arietinum] Length = 815 Score = 190 bits (483), Expect = 2e-54 Identities = 91/104 (87%), Positives = 96/104 (92%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH AL VYDRM+EE LKPNQTTFVSLLTACSHSGLVEEG+TLFH MERDHNIKP+ Sbjct: 520 GMHGQGHQALVVYDRMLEEGLKPNQTTFVSLLTACSHSGLVEEGRTLFHSMERDHNIKPS 579 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCR 15 D HYAC VDLLSRAGCLEEADALVKQ+P EPS DVLEALLSGC+ Sbjct: 580 DTHYACFVDLLSRAGCLEEADALVKQIPVEPSTDVLEALLSGCK 623 >XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] ESW29714.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] Length = 820 Score = 190 bits (482), Expect = 2e-54 Identities = 92/107 (85%), Positives = 98/107 (91%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH ALGVY RMIEERLKPNQTTFVSLLTACSHSGLVEEGK LF C+ERDHNIKP Sbjct: 525 GMHGLGHYALGVYGRMIEERLKPNQTTFVSLLTACSHSGLVEEGKALFDCIERDHNIKPQ 584 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 +KHYAC+VDLLSRAG L+EADALVKQMPF+PS DVLEALLSGCRT + Sbjct: 585 EKHYACLVDLLSRAGRLKEADALVKQMPFQPSTDVLEALLSGCRTHK 631 >XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183991.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183992.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] Length = 840 Score = 190 bits (482), Expect = 3e-54 Identities = 91/107 (85%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH ALGV+ RMIEE +KPNQTTF+SLLTACSHSGLVEEGKTLFH MERDH IKP+ Sbjct: 545 GMHGYGHQALGVFGRMIEEGVKPNQTTFISLLTACSHSGLVEEGKTLFHSMERDHGIKPS 604 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG LEEAD LVKQMPFEPS DVLEALLSGCRT + Sbjct: 605 DKHYACLVDLLSRAGHLEEADTLVKQMPFEPSTDVLEALLSGCRTHK 651 >XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950446.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950447.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950449.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950450.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] Length = 840 Score = 190 bits (482), Expect = 3e-54 Identities = 91/107 (85%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH ALGV+ RMIEE +KPNQTTF+SLLTACSHSGLVEEGKTLFH MERDH IKP+ Sbjct: 545 GMHGYGHQALGVFGRMIEEGVKPNQTTFISLLTACSHSGLVEEGKTLFHSMERDHGIKPS 604 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG LEEAD LVKQMPFEPS DVLEALLSGCRT + Sbjct: 605 DKHYACLVDLLSRAGHLEEADTLVKQMPFEPSTDVLEALLSGCRTHK 651 >KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angularis] Length = 797 Score = 188 bits (477), Expect = 1e-53 Identities = 90/107 (84%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH AL +YDRMIEE LKP+QTTF+SLLTACSHSGLVEEGK LF+CMERDHNIKP Sbjct: 502 GMHGLGHYALSLYDRMIEESLKPSQTTFISLLTACSHSGLVEEGKALFNCMERDHNIKPQ 561 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYACVVDLLSRAG L+EADALVKQMPF+PS DV EALLSGCRT + Sbjct: 562 DKHYACVVDLLSRAGRLKEADALVKQMPFQPSTDVFEALLSGCRTHK 608 >XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna angularis] Length = 820 Score = 188 bits (477), Expect = 1e-53 Identities = 90/107 (84%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH AL +YDRMIEE LKP+QTTF+SLLTACSHSGLVEEGK LF+CMERDHNIKP Sbjct: 525 GMHGLGHYALSLYDRMIEESLKPSQTTFISLLTACSHSGLVEEGKALFNCMERDHNIKPQ 584 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYACVVDLLSRAG L+EADALVKQMPF+PS DV EALLSGCRT + Sbjct: 585 DKHYACVVDLLSRAGRLKEADALVKQMPFQPSTDVFEALLSGCRTHK 631 >XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna radiata var. radiata] Length = 848 Score = 187 bits (475), Expect = 3e-53 Identities = 90/107 (84%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH AL +YDRMIEE LKP+QTTFVSLLTACSHSGLVEEGK LF+CMERDHNIKP Sbjct: 553 GMHGLGHYALALYDRMIEESLKPSQTTFVSLLTACSHSGLVEEGKALFNCMERDHNIKPQ 612 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG L+EADALVKQMPF+PS DV EALLSGCRT + Sbjct: 613 DKHYACLVDLLSRAGRLKEADALVKQMPFQPSTDVFEALLSGCRTHK 659 >XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH30891.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 814 Score = 186 bits (472), Expect = 6e-53 Identities = 90/104 (86%), Positives = 95/104 (91%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH AL VYDRMI+ERLKPNQTTFVS+LTACSHSGLVEEG+TLFHCMER HNIKP+ Sbjct: 519 GMHGQGHQALRVYDRMIDERLKPNQTTFVSMLTACSHSGLVEEGRTLFHCMERVHNIKPS 578 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCR 15 DKHYAC VDLLSRAG LEEA ALVKQ+P EPS DVLEALL GCR Sbjct: 579 DKHYACFVDLLSRAGYLEEAYALVKQIPVEPSIDVLEALLGGCR 622 >XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Lupinus angustifolius] Length = 813 Score = 183 bits (464), Expect = 8e-52 Identities = 88/107 (82%), Positives = 97/107 (90%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG GH A+GVYDRM+EE LKPNQ TFVSLLTACSHSGLVE+GK+LF ME+DHNIKP+ Sbjct: 518 GMHGHGHHAIGVYDRMMEEGLKPNQITFVSLLTACSHSGLVEKGKSLFLSMEKDHNIKPS 577 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 DKHYAC+VDLLSRAG LEEA+ALVKQMPFEPS VLEALLSGCRT + Sbjct: 578 DKHYACLVDLLSRAGHLEEANALVKQMPFEPSSSVLEALLSGCRTHK 624 >KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 706 Score = 181 bits (460), Expect = 1e-51 Identities = 88/107 (82%), Positives = 94/107 (87%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG G ALGVY RMIEERLKPNQTTFVSLLTACSHSGLVEEGK LFH MERDH+++P Sbjct: 411 GMHGHGRYALGVYSRMIEERLKPNQTTFVSLLTACSHSGLVEEGKALFHSMERDHDVRPQ 470 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 KHYAC+VDL SRAG LEEAD LVKQMPF+PS DVLEALLSGCRT + Sbjct: 471 HKHYACLVDLHSRAGRLEEADELVKQMPFQPSTDVLEALLSGCRTHK 517 >XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] KRG89280.1 hypothetical protein GLYMA_20G013300 [Glycine max] Length = 821 Score = 181 bits (460), Expect = 3e-51 Identities = 88/107 (82%), Positives = 94/107 (87%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG G ALGVY RMIEERLKPNQTTFVSLLTACSHSGLVEEGK LFH MERDH+++P Sbjct: 526 GMHGHGRYALGVYSRMIEERLKPNQTTFVSLLTACSHSGLVEEGKALFHSMERDHDVRPQ 585 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 KHYAC+VDL SRAG LEEAD LVKQMPF+PS DVLEALLSGCRT + Sbjct: 586 HKHYACLVDLHSRAGRLEEADELVKQMPFQPSTDVLEALLSGCRTHK 632 >XP_018845279.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Juglans regia] Length = 791 Score = 177 bits (448), Expect = 1e-49 Identities = 83/107 (77%), Positives = 96/107 (89%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH A+GVY +MIE+ LKPNQTTFV+LLTACSHSGLVE+G LFH MERDHNI+PT Sbjct: 496 GMHGQGHQAVGVYQKMIEQGLKPNQTTFVALLTACSHSGLVEDGIILFHKMERDHNIRPT 555 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 +KHYAC VDLLSRAG +EEA+ALV++MPF+PS VLEALLSGCRT + Sbjct: 556 EKHYACFVDLLSRAGRIEEAEALVRKMPFQPSSAVLEALLSGCRTHR 602 >XP_015873004.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial-like, partial [Ziziphus jujuba] Length = 400 Score = 158 bits (400), Expect = 6e-45 Identities = 72/107 (67%), Positives = 88/107 (82%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 G+HG GH A+ +Y RM EE +KPN+T+F+SLLTACSHSGLVEEG LFH MERDHNIKPT Sbjct: 239 GIHGHGHQAVDIYRRMKEEGVKPNETSFLSLLTACSHSGLVEEGINLFHSMERDHNIKPT 298 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 KHYA +VDLLSRAG +EA+A ++QMPFEP + EALL+GC+T + Sbjct: 299 QKHYASIVDLLSRAGRFKEAEAFIEQMPFEPGSSIFEALLNGCQTHK 345 >XP_002271063.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vitis vinifera] XP_019080794.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vitis vinifera] Length = 805 Score = 161 bits (408), Expect = 5e-44 Identities = 75/107 (70%), Positives = 92/107 (85%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHG G+ A+G+Y +MIEE LKPNQTTF+SLL+ACSHS LVE+G +LF+ MERDHNI+P Sbjct: 510 GMHGHGYQAVGIYHKMIEEGLKPNQTTFLSLLSACSHSRLVEQGISLFNSMERDHNIRPI 569 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 +KHYAC+VDLLSRAG EEA AL+++MPF+P VLEALLSGCRT + Sbjct: 570 EKHYACLVDLLSRAGRFEEAQALIEKMPFQPGTAVLEALLSGCRTHK 616 >XP_017976251.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Theobroma cacao] Length = 815 Score = 161 bits (408), Expect = 5e-44 Identities = 75/107 (70%), Positives = 92/107 (85%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH AL ++ RM+EE +KP+QTTF+SLL+ACSHSGLV +G++LF ME DHNI+PT Sbjct: 520 GMHGQGHKALDIFRRMLEEGVKPSQTTFISLLSACSHSGLVNQGRSLFVSMESDHNIRPT 579 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 +KHYAC VDLLSRAG L+EA+AL+KQMPF+ S V EALLSGCRT + Sbjct: 580 EKHYACYVDLLSRAGRLQEAEALIKQMPFQSSGAVFEALLSGCRTHK 626 >EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 815 Score = 161 bits (407), Expect = 7e-44 Identities = 75/107 (70%), Positives = 92/107 (85%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH AL ++ RM+EE +KP+QTTF+SLL+ACSHSGLV +G++LF ME DHNI+PT Sbjct: 520 GMHGQGHKALDIFCRMLEEGVKPSQTTFISLLSACSHSGLVNQGRSLFVSMESDHNIRPT 579 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 +KHYAC VDLLSRAG L+EA+AL+KQMPF+ S V EALLSGCRT + Sbjct: 580 EKHYACYVDLLSRAGRLQEAEALIKQMPFQSSGAVFEALLSGCRTHK 626 >XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Gossypium hirsutum] Length = 498 Score = 155 bits (392), Expect = 6e-43 Identities = 71/104 (68%), Positives = 89/104 (85%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 GMHGQGH AL +Y RM+EE LKPN+TTFVSLL+ACSHSG V++G++LF ME DHNI+ Sbjct: 203 GMHGQGHKALDLYRRMLEEGLKPNKTTFVSLLSACSHSGFVDQGRSLFLSMESDHNIRAN 262 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCR 15 +KHYAC VDLLSRAG ++EA+ L+KQMPF+ S++V EALL+GCR Sbjct: 263 EKHYACYVDLLSRAGHIKEAEVLIKQMPFQSSREVFEALLNGCR 306 >XP_015868900.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Ziziphus jujuba] XP_015868901.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Ziziphus jujuba] XP_015868902.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Ziziphus jujuba] Length = 819 Score = 158 bits (400), Expect = 6e-43 Identities = 72/107 (67%), Positives = 88/107 (82%) Frame = -1 Query: 326 GMHGQGHDALGVYDRMIEERLKPNQTTFVSLLTACSHSGLVEEGKTLFHCMERDHNIKPT 147 G+HG GH A+ +Y RM EE +KPN+T+F+SLLTACSHSGLVEEG LFH MERDHNIKPT Sbjct: 524 GIHGHGHQAVDIYRRMKEEGVKPNETSFLSLLTACSHSGLVEEGINLFHSMERDHNIKPT 583 Query: 146 DKHYACVVDLLSRAGCLEEADALVKQMPFEPSKDVLEALLSGCRTQQ 6 KHYA +VDLLSRAG +EA+A ++QMPFEP + EALL+GC+T + Sbjct: 584 QKHYASIVDLLSRAGRFKEAEAFIEQMPFEPGSSIFEALLNGCQTHK 630